Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.07
PubTator Score 1.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 3.0

Gene RIF (1)

AA Sequence

MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIMTFSFGVIFLF      1 - 70
TLLKPYPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIMNFLSALGAIAGIILLTFGFI     71 - 140
LDQNYICGYSHQNSQCKAVTVLFLGILITLMTFSIIELFISLPFSILGCHSEDCDCEQCC              141 - 200
//

Text Mined References (8)

PMID Year Title