Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.01
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.6e-23
osteosarcoma 7950 2.5e-04
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.038 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.009 2.5e-04
psoriasis -1.100 5.6e-23

Gene RIF (1)

AA Sequence

MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAGAGVGSWLLVL      1 - 70
YLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWS     71 - 140
PALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECG    141 - 210
ARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSH    211 - 280
SAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHT    281 - 350
HPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLV    351 - 420
GVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQDSLL                                     421 - 457
//

Text Mined References (6)

PMID Year Title