Property Summary

NCBI Gene PubMed Count 5
Grant Count 6
Funding $448,572
PubMed Score 3.07
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.009 0.000
psoriasis -1.100 0.000

Gene RIF (1)

PMID Text
12484779 The purified IGF-binding protein-5 (IGFBP-5) protease fraction secreted by cultured human osteoblasts has been characterized as ADAM9.

AA Sequence

MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAGAGVGSWLLVL      1 - 70
YLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWS     71 - 140
PALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECG    141 - 210
ARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSH    211 - 280
SAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHT    281 - 350
HPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLV    351 - 420
GVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQDSLL                                     421 - 457
//

Text Mined References (6)

PMID Year Title
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
17918732 2008 An integrated genetic and functional analysis of the role of type II transmembrane serine proteases (TMPRSSs) in hearing loss.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12484779 2002 ADAM-9 is an insulin-like growth factor binding protein-5 protease produced and secreted by human osteoblasts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741986 2002 Spinesin/TMPRSS5, a novel transmembrane serine protease, cloned from human spinal cord.