Property Summary

NCBI Gene PubMed Count 27
PubMed Score 49.42
PubTator Score 29.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
CONE-ROD DYSTROPHY 10 1 0.0 0.0
Retinitis pigmentosa 35 4 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 3.6e-07
lung cancer 4740 2.4e-05
glioblastoma 5792 2.5e-04
psoriasis 6694 6.2e-04
osteosarcoma 7950 3.9e-03
astrocytoma 1146 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Retinal Degeneration 106 3.021 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.200 1.2e-02
glioblastoma -1.500 2.5e-04
lung cancer -3.200 2.4e-05
lung carcinoma -1.200 3.6e-07
osteosarcoma -1.280 3.9e-03
psoriasis 1.100 6.2e-04

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (15)

AA Sequence

MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLS      1 - 70
GDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLY     71 - 140
TCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLYSGTMNNFLGSEPILMR    141 - 210
TLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQ    211 - 280
KKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVF    281 - 350
KGKYKELNKETSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV    351 - 420
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVW    421 - 490
RVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQS    491 - 560
RPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENG    561 - 630
FSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALI    631 - 700
ILVASPLRALRARGKVQGCETLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA             701 - 761
//

Text Mined References (28)

PMID Year Title