Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
R01 Count 2
Funding $447,162
PubMed Score 57.46
PubTator Score 29.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.100 0.001
glioblastoma -1.500 0.000
osteosarcoma -1.280 0.004
astrocytoma -1.200 0.012
lung cancer -3.300 0.000
lung carcinoma -1.200 0.000

Gene RIF (11)

PMID Text
26648031 Sema4A activated the Akt pathway via Plexin D1 receptor in lung fibroblasts.Lung fibroblasts show elevated levels of Sema4A expression in systemic sclerosis patients.
26303122 Data suggest that increased expression of semaphorin 4A (Sema4A) is required to promote inflammation of rheumatoid arthritis (RA).
25515530 PACAP released from retinal neural cells (photoreceptors or optic nerve cells) may regulate Sema4A expression in retinal pigment epithelial cells and thereby contribute to the maintenance of retinal structure and function.
25307848 Germline variants in SEMA4A predispose to familial colorectal cancer type X.
23360997 These results indicate the importance of the Sema4A protein conformation in human and mouse retina homeostasis.
23007237 Sema4A plays an inhibitory role in T helper (Th)2-type allergic diseases, such as allergic asthma, in a fraction of Sema4a-deficient transgenic mice.
22956603 mutations in SEMA4A may cause susceptibility to light exposure, oxidative stress, and ER stress, which may be involved in the progression and pathology of RP.
22491253 Dendritic cell-derived SEM4A is not only critical for T helper type (Th)1 cells but also for Th17 cell differentiation, and multiple sclerosis patients with high Sema4A levels exhibit Th17 cell skewing.
20801516 Observational study of genetic testing. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLS      1 - 70
GDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLY     71 - 140
TCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLYSGTMNNFLGSEPILMR    141 - 210
TLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQ    211 - 280
KKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVF    281 - 350
KGKYKELNKETSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV    351 - 420
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVW    421 - 490
RVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQS    491 - 560
RPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENG    561 - 630
FSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALI    631 - 700
ILVASPLRALRARGKVQGCETLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA             701 - 761
//

Text Mined References (24)

PMID Year Title
26648031 2015 Semaphorin 4A enhances lung fibrosis through activation of Akt via PlexinD1 receptor.
26303122 2015 Expression of Semaphorin 4A and its potential role in rheumatoid arthritis.
25515530 2015 Up-regulation of semaphorin 4A expression in human retinal pigment epithelial cells by PACAP released from cocultured neural cells.
25307848 2014 Germline variants in the SEMA4A gene predispose to familial colorectal cancer type X.
23360997 2013 A point mutation in Semaphorin 4A associates with defective endosomal sorting and causes retinal degeneration.
23007237 2013 An inhibitory role for Sema4A in antigen-specific allergic asthma.
22956603 2012 SEMA4A mutations lead to susceptibility to light irradiation, oxidative stress, and ER stress in retinal pigment epithelial cells.
22491253 2012 Elevation of Sema4A implicates Th cell skewing and the efficacy of IFN-? therapy in multiple sclerosis.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...