Property Summary

NCBI Gene PubMed Count 32
PubMed Score 34.58
PubTator Score 36.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.726 1.7e-04
adult high grade glioma 1.700 9.7e-04
atypical teratoid / rhabdoid tumor 1.900 2.1e-06
ependymoma 1.600 1.5e-10
glioblastoma 2.400 5.1e-09
group 3 medulloblastoma 3.300 1.5e-07
medulloblastoma, large-cell 3.200 1.8e-08
nasopharyngeal carcinoma 1.500 1.4e-04
non-small cell lung cancer 1.835 1.3e-18
osteosarcoma -1.961 1.2e-03
primitive neuroectodermal tumor 2.800 1.5e-06

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (20)

AA Sequence

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE      1 - 70
QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI     71 - 140
MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT    141 - 210
VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM                                     211 - 247
//

Text Mined References (40)

PMID Year Title