Property Summary

NCBI Gene PubMed Count 32
Grant Count 5
R01 Count 5
Funding $752,650
PubMed Score 32.71
PubTator Score 36.44

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (20)

PMID Text
26378239 propose that CSPP1 cooperates with CENP-H on kinetochores to serve as a novel regulator of kinetochore microtubule dynamics for accurate chromosome segregation
26248586 Upregulation of centromere protein H is associated with progression of renal cell carcinoma
23970101 CENP-H was overexpressed in HCC, and its level of upregulation was an independent prognostic indicator, suggesting that CENP-H may be an effective therapeutic strategy for the treatment of HCC.
22999412 High expression of CENP-H in gastric cancer indicates poor prognosis and Survivin may mediate its procancer role.
22682030 Sp1 and Sp3 bind to the CENPH minimal promoter and function as a regulator of the transcription of CENPH in nasopharyngeal carcinomas.
22631655 upregulated CENP-H and Ki67 levels are significantly associated with short relapse-free survival in hypopharyngeal squamous cell carcinoma (HSSC); these factors may be predictors of a relapsing phenotype in HSSC cases
22381774 CENP-H promotes the proliferation of human gastric cancer cells
21880184 Breast cancer patients with high CENP-H expression had short overall survival. CENP-H expression was related with clinical stage.
21875947 HIV-1 Vpr and p300/HAT co-localizes with CENP-A and CENP-H proteins in the centromere and arm region of chromosome
19625449 CENP-H-containing complex facilitates deposition of newly synthesized CENP-A into centromeric chromatin in cooperation with FACT and CHD1.
More...

AA Sequence

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE      1 - 70
QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI     71 - 140
MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT    141 - 210
VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM                                     211 - 247
//

Text Mined References (39)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26378239 2015 Mitotic Protein CSPP1 Interacts with CENP-H Protein to Coordinate Accurate Chromosome Oscillation in Mitosis.
26248586 2015 Upregulation of centromere protein H is associated with progression of renal cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
23970101 2013 Overexpression of CENP-H as a novel prognostic biomarker for human hepatocellular carcinoma progression and patient survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22999412 2013 Combined evaluation of centromere protein H and Ki-67 as prognostic biomarker for patients with gastric carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22682030 2012 Sp1 and Sp3 are involved in the full transcriptional activity of centromere protein H in human nasopharyngeal carcinoma cells.
22631655 2012 Role of centromere protein H and Ki67 in relapse-free survival of patients after primary surgery for hypopharyngeal cancer.
More...