Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.87
PubTator Score 13.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 7.1e-10
osteosarcoma 7766 4.9e-07

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.649 4.9e-07
psoriasis -1.700 7.1e-10

Gene RIF (4)

AA Sequence

MMSMLGGLQRYFRVILLLLLALTLLLLAGFLHSDLELDTPLFGGQAEGPPVTNIMFLKTHKTASSTVLNI      1 - 70
LYRFAETHNLSVALPAGSRVHLGYPWLFLARYVEGVGSQQRFNIMCNHLRFNLPQVQKVMPNDTFYFSIL     71 - 140
RNPVFQLESSFIYYKTYAPAFRGAPSLDAFLASPRTFYNDSRHLRNVYAKNNMWFDFGFDPNAQCEEGYV    141 - 210
RARIAEVERRFRLVLIAEHLDESLVLLRRRLRWALDDVVAFRLNSRSARSVARLSPETRERARSWCALDW    211 - 280
RLYEHFNRTLWAQLRAELGPRRLRGEVERLRARRRELASLCLQDGGALKNHTQIRDPRLRPYQSGKADIL    281 - 350
GYNLRPGLDNQTLGVCQRLVMPELQYMARLYALQFPEKPLKNIPFLGA                          351 - 398
//

Text Mined References (16)

PMID Year Title