Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.59
PubTator Score 13.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.649 0.000
psoriasis -1.700 0.000

Synonym

Accession Q9H3Q3 Q17RK0 Q57Z52 Gal3ST-2
Symbols GP3ST
GAL3ST-2

Gene

Gene RIF (3)

PMID Text
25532485 GAL3ST2 is present in breast cancer cell lines and is more strongly expressed in more metastatic tumors.
15926885 The substrate specificity and cofactor requirements of human, porcine, and murine GAL3ST are reported
15921657 Gal3ST-2 is involved in tumor metastasis process by regulation of adhesion ability to selectins and expression of integrin alphaV but not beta3

AA Sequence

MMSMLGGLQRYFRVILLLLLALTLLLLAGFLHSDLELDTPLFGGQAEGPPVTNIMFLKTHKTASSTVLNI      1 - 70
LYRFAETHNLSVALPAGSRVHLGYPWLFLARYVEGVGSQQRFNIMCNHLRFNLPQVQKVMPNDTFYFSIL     71 - 140
RNPVFQLESSFIYYKTYAPAFRGAPSLDAFLASPRTFYNDSRHLRNVYAKNNMWFDFGFDPNAQCEEGYV    141 - 210
RARIAEVERRFRLVLIAEHLDESLVLLRRRLRWALDDVVAFRLNSRSARSVARLSPETRERARSWCALDW    211 - 280
RLYEHFNRTLWAQLRAELGPRRLRGEVERLRARRRELASLCLQDGGALKNHTQIRDPRLRPYQSGKADIL    281 - 350
GYNLRPGLDNQTLGVCQRLVMPELQYMARLYALQFPEKPLKNIPFLGA                          351 - 398
//

Text Mined References (15)

PMID Year Title
25532485 2015 GAL3ST2 from mammary gland epithelial cells affects differentiation of 3T3-L1 preadipocytes.
25416956 2014 A proteome-scale map of the human interactome network.
15926885 2005 Porcine, mouse and human galactose 3-O-sulphotransferase-2 enzymes have different substrate specificities; the porcine enzyme requires basic compounds for its catalytic activity.
15921657 2005 Gal3ST-2 involved in tumor metastasis process by regulation of adhesion ability to selectins and expression of integrins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14701868 2004 Identification of physiologically relevant substrates for cloned Gal: 3-O-sulfotransferases (Gal3STs): distinct high affinity of Gal3ST-2 and LS180 sulfotransferase for the globo H backbone, Gal3ST-3 for N-glycan multiterminal Galbeta1, 4GlcNAcbeta units and 6-sulfoGalbeta1, 4GlcNAcbeta, and Gal3ST-4 for the mucin core-2 trisaccharide.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036446 2002 Down-regulation of Gal 3-O-sulfotransferase-2 (Gal3ST-2) expression in human colonic non-mucinous adenocarcinoma.
11926988 2002 The possibility of reducing xenoantigen levels with a novel gal 3'-sulfotransferase (GP3ST).
More...