Property Summary

NCBI Gene PubMed Count 25
PubMed Score 73.31
PubTator Score 12.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Psychotic Disorders 20
Disease Target Count P-value
lung carcinoma 2844 4.13210851841867E-12
posterior fossa group B ependymoma 1530 1.10704195501653E-10
chronic lymphosyte leukemia 232 2.82030950264037E-9
tuberculosis 1563 8.95350997421561E-8
pilocytic astrocytoma 3086 1.7455879731832E-7
ovarian cancer 8492 3.35045454193257E-6
Duchenne muscular dystrophy 602 3.40040283415648E-6
pituitary cancer 1972 2.35027207025391E-5
ulcerative colitis 2087 2.62591507327919E-5
malignant mesothelioma 3163 5.38884380837408E-5
lung cancer 4473 5.8382847071801E-5
lung adenocarcinoma 2714 1.62993402203037E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.46389314142185E-4
primary Sjogren syndrome 789 8.38633072811926E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.58296566371546E-4
glioblastoma 5572 0.00143356147303556
head and neck cancer 270 0.00225607381320618
adult high grade glioma 2148 0.003275399883057
interstitial cystitis 2299 0.00646076514224867
acute myeloid leukemia 785 0.0125729868494455
facioscapulohumeral dystrophy 286 0.0162343258379312
colon cancer 1475 0.0182348083795003
group 3 medulloblastoma 2254 0.0184283260365826
gastric carcinoma 832 0.020915515183326
diabetes mellitus 1663 0.0307676498548634

Expression

  Differential Expression (25)

Synonym

Accession Q9H3G5 A4D1A4 Q6UX20 Q8NBL7 Q96AR7 Q9HB41
Symbols HVLP

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of vitellogenic-like carboxypeptidase (CPVL) in peptide-treated PBMCs
21911749 genetic association studies in a Chinese population with type 2 diabetes: An SNP in CPVL (rs39059) is associated with diabetic retinopathy in a Chinese population of type 2 diabetic patients.
20460425 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN      1 - 70
MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF     71 - 140
PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV    141 - 210
PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK    211 - 280
QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN    281 - 350
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK    351 - 420
IFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG                  421 - 476
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132900 2013 Genome-wide association study of atypical psychosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21911749 2011 CPVL/CHN2 genetic variant is associated with diabetic retinopathy in Chinese type 2 diabetic patients.
21269460 2011 Initial characterization of the human central proteome.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...