Property Summary

NCBI Gene PubMed Count 25
PubMed Score 74.36
PubTator Score 12.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute myeloid leukemia -1.600 1.3e-02
adult high grade glioma 1.600 3.3e-03
Astrocytoma, Pilocytic 1.500 1.8e-07
chronic lymphosyte leukemia -1.800 2.8e-09
colon cancer -1.300 1.8e-02
diabetes mellitus -1.200 3.1e-02
Duchenne muscular dystrophy 1.080 3.4e-06
ependymoma 1.900 3.0e-10
facioscapulohumeral dystrophy 1.900 1.6e-02
gastric carcinoma 2.100 2.1e-02
glioblastoma 1.300 5.0e-04
group 3 medulloblastoma -1.100 1.8e-02
head and neck cancer -1.300 2.3e-03
interstitial cystitis 1.200 6.5e-03
intraductal papillary-mucinous adenoma (... -2.500 8.6e-04
intraductal papillary-mucinous carcinoma... -2.800 2.5e-04
lung adenocarcinoma -1.400 1.6e-04
lung cancer -2.000 5.8e-05
lung carcinoma -1.400 4.1e-12
malignant mesothelioma 1.800 5.4e-05
ovarian cancer -2.600 3.4e-06
pituitary cancer -1.400 2.4e-05
primary Sjogren syndrome 1.500 8.4e-04
tuberculosis 1.800 9.0e-08
ulcerative colitis 1.500 2.6e-05

Gene RIF (4)

AA Sequence

MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN      1 - 70
MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF     71 - 140
PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV    141 - 210
PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK    211 - 280
QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN    281 - 350
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK    351 - 420
IFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG                  421 - 476
//

Text Mined References (29)

PMID Year Title