Property Summary

NCBI Gene PubMed Count 634
Grant Count 43
R01 Count 26
Funding $11,460,114.34
PubMed Score 1176.35
PubTator Score 1791.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (62)

Disease Z-score Confidence
Rapp-Hodgkin syndrome 6 6.062 3.0
Cleft Lip 91 5.473 2.7
ADULT syndrome 9 5.03 2.5
Syndactyly 56 4.652 2.3
Cleft palate 125 4.553 2.3
Lacrimal duct obstruction 5 4.553 2.3
Cancer 2,346 4.235 2.1
Tooth agenesis 36 3.782 1.9
Hypohidrosis 13 3.617 1.8
Tyrosinemia type II 6 3.47 1.7
Restless legs syndrome 28 3.443 1.7
Focal dermal hypoplasia 9 3.195 1.6
Nonsyndromic congenital nail disorder 1 3 3.139 1.6
Leiomyoma 25 3.002 1.5
Adenocarcinoma 115 2.0
Adenocarcinoma of lung (disorder) 48
Amyotrophic Lateral Sclerosis 431
Bladder Exstrophy 2
Breast Diseases 1
Breast cancer 3,094
Carcinoma 2,147 1.0
Colorectal Neoplasms 217
Congenital Foot Deformity 4
Congenital Hand Deformities 8
Craniofacial Abnormalities 147
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND ... 1 
Ectrodactyly 6
Female Urogenital Diseases 18
Hay-Wells syndrome 1
LIMB-MAMMARY SYNDROME 1
Leukemia, Lymphocytic, Acute, L1 11
Limb Deformities, Congenital 16
Lung Neoplasms 171
Lymphoid leukemia 69 2.0
Malignant neoplasm of lung 16
Neoplasm Metastasis 138
Neoplastic Cell Transformation 81
OROFACIAL CLEFT 8 1
Pancreatic Neoplasm 79
Rudiger syndrome 1 1
SPLIT-HAND/FOOT MALFORMATION 4 1
Skin Abnormalities 10
Squamous Cell Neoplasms 3
Squamous cell carcinoma 94
Sweat Gland Neoplasms 1
acute quadriplegic myopathy 1,157
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
dermatomyositis 933
esophageal adenocarcinoma 737
glioblastoma 5,572
interstitial cystitis 2,299
juvenile dermatomyositis 1,189
lung cancer 4,466 2.0
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
ovarian neoplasm 97
psoriasis 6,685

Expression

  Differential Expression (17)

Synonym

Accession Q9H3D4 O75080 O75195 O75922 O76078 Q6VEG2 Q6VEG3 Q6VEG4 Q6VFJ1 Q6VFJ2 Q6VFJ3 Q6VH20 Q7LDI3 Q7LDI4 Q7LDI5 Q96KR0 Q9H3D2 Q9H3D3 Q9H3P8 Q9NPH7 Q9P1B4 Q9P1B5 Q9P1B6 Q9P1B7 Q9UBV9 Q9UE10 Q9UP26 Q9UP27 Q9UP28 Q9UP74 p63
Symbols AIS
KET
LMS
NBP
RHS
p40
p51
p63
EEC3
OFC8
p73H
p73L
SHFM4
TP53L
TP73L
p53CP
TP53CP
B(p51A)
B(p51B)

Gene

PANTHER Protein Class (1)

PDB

1RG6   2RMN   2Y9T   2Y9U   3QYM   3QYN   3US0   3US1   3US2   3ZY0   3ZY1   4A9Z  

Gene RIF (578)

PMID Text
26995965 Tumor suppressor p63 regulates expression of ubiquitin ligase PIRH2.
26919175 Altogether, these results suggest a novel function for p63 as a contributor to muscular atrophic processes via the regulation of multiple genes, including the muscle atrophy gene Trim63.
26819410 DeltaNp63 is a key factor promoting both proliferation and DNA repair in squamous cell carcinoma
26696549 The immunocytochemical expressions of napsin A and p40 in imprint cytology seem to be of great utility for the accurate histological differentiation of lung cancers.
26695686 T allele reduced the post-transcriptional levels of TP63 mediated by interfering binding efficiency of miR-140-5p. In addition, overexpression of miR-140-5p inhibited bladder cancer cell proliferation and attenuated cell migration
26694167 results suggest that baicalein-mediated ASK1/JNK activation regulates the mitochondria-dependent apoptosis pathway through the up-regulation of TAp63 and down-regulation of NF-kappaB and CD74/CD44 in B-cell malignancies
26554466 demonstrated the role of OTX2 on TAp63 regulation necessary for the correct formation of macular neuroepithelium
26519559 novel regulation of TAp63gamma transactivity and pro-apoptotic activity mediated by JNK1
26470833 We report a multiplex nonconsanguineous family with TP63 nonsense mutation leading to a premature termination codon (PTC) (p.Gln16X), but the same mutation gave rise to marked phenotypic variability
26464669 p63 is a sensitive marker in the diagnosis of mucoepidermoid carcinoma
More...

AA Sequence

MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQ      1 - 70
PIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQ     71 - 140
NSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCP    141 - 210
IQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPI    211 - 280
TGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR    281 - 350
DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES    351 - 420
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNAL    421 - 490
TPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSS    491 - 560
CLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGS    561 - 630
SETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE                        631 - 680
//

Text Mined References (638)

PMID Year Title
27172897 2016 LTR12 promoter activation in a broad range of human tumor cells by HDAC inhibition.
27021569 2016 Quality control in oocytes by p63 is based on a spring-loaded activation mechanism on the molecular and cellular level.
26995965 2015 [TUMOR SUPPRESSOR p63 REGULATES EXPRESSION OF UBIQUITIN LIGASE Pirh2].
26919175 2016 Transcriptional activator TAp63 is upregulated in muscular atrophy during ALS and induces the pro-atrophic ubiquitin ligase Trim63.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26819410 2016 ?Np63 activates the Fanconi anemia DNA repair pathway and limits the efficacy of cisplatin treatment in squamous cell carcinoma.
26696549 2015 Expressions of Thyroid Transcription Factor-1, Napsin A, p40, p63, CK5/6 and Desmocollin-3 in Non-Small Cell Lung Cancer, as Revealed by Imprint Cytology Using a Malinol-Based Cell-Transfer Technique.
26695686 2016 A functional variant in TP63 at 3q28 associated with bladder cancer risk by creating an miR-140-5p binding site.
26694167 2016 ASK1/JNK-mediated TAp63 activation controls the cell survival signal of baicalein-treated EBV-transformed B cells.
26554466 2015 OTX2 regulates the expression of TAp63 leading to macular and cochlear neuroepithelium development.
More...