Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (233)

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MSDSNLSDNHLPDTFFLTGIPGLEAAHFWIAIPFCAMYLVALVGNAALILVIAMDNALHAPMYLFLCLLS      1 - 70
LTDLALSSTTVPKMLAILWLHAGEISFGGCLAQMFCVHSIYALESSILLAMAFDRYVAICNPLRYTTILN     71 - 140
HAVIGRIGFVGLFRSVAIVSPFIFLLRRLPYCGHRVMTHTYCEHMGIARLACANITVNIVYGLTVALLAM    141 - 210
GLDSILIAISYGFILHAVFHLPSHDAQHKALSTCGSHIGIILVFYIPAFFSFLTHRFGHHEVPKHVHIFL    211 - 280
ANLYVLVPPVLNPILYGARTKEIRSRLLKLLHLGKTSI                                    281 - 318
//

Text Mined References (6)

PMID Year Title