Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (233)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDSNLSDNHLPDTFFLTGIPGLEAAHFWIAIPFCAMYLVALVGNAALILVIAMDNALHAPMYLFLCLLS      1 - 70
LTDLALSSTTVPKMLAILWLHAGEISFGGCLAQMFCVHSIYALESSILLAMAFDRYVAICNPLRYTTILN     71 - 140
HAVIGRIGFVGLFRSVAIVSPFIFLLRRLPYCGHRVMTHTYCEHMGIARLACANITVNIVYGLTVALLAM    141 - 210
GLDSILIAISYGFILHAVFHLPSHDAQHKALSTCGSHIGIILVFYIPAFFSFLTHRFGHHEVPKHVHIFL    211 - 280
ANLYVLVPPVLNPILYGARTKEIRSRLLKLLHLGKTSI                                    281 - 318
//

Text Mined References (6)

PMID Year Title
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.