Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (136)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

AA Sequence

MKISNNSLGFLPTTFILVGIPGLESEHLWISVPFSLIYIIIFLGNGIILHVIRTDIALHQPMYLFLAMLA      1 - 70
LAEVRVSASTLPTVLGIFLFGNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPTELHSYPD     71 - 140
TAQGLWHRSYYRTEKHYAHGSVAHSLMASALLWPQCPLTFLLSAPQSYLSCGNISVNNIYGIFIVTSTFG    141 - 210
LDSLLIVISYGLILHTVLGIATGEGRKKALNTCGSHVCAVLAYYVPMIGLSIVHRLGHRVSPLLQAMMAN    211 - 280
AYLFFPPVVNPIVYSIKTKEIHGAIVRMLLEKRRRV                                      281 - 316
//

Text Mined References (3)

PMID Year Title
17973576 2007 Genetic elucidation of human hyperosmia to isovaleric acid.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.