Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (136)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.5e-06

AA Sequence

MKISNNSLGFLPTTFILVGIPGLESEHLWISVPFSLIYIIIFLGNGIILHVIRTDIALHQPMYLFLAMLA      1 - 70
LAEVRVSASTLPTVLGIFLFGNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPTELHSYPD     71 - 140
TAQGLWHRSYYRTEKHYAHGSVAHSLMASALLWPQCPLTFLLSAPQSYLSCGNISVNNIYGIFIVTSTFG    141 - 210
LDSLLIVISYGLILHTVLGIATGEGRKKALNTCGSHVCAVLAYYVPMIGLSIVHRLGHRVSPLLQAMMAN    211 - 280
AYLFFPPVVNPIVYSIKTKEIHGAIVRMLLEKRRRV                                      281 - 316
//

Text Mined References (5)

PMID Year Title