Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.58

Knowledge Summary

Patent (190)

Gene RIF (1)

PMID Text
20018918 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLNKSASTFQLTGFPGMEKAHHWIFIPLLAAYISILLGNGTLLFLIRNDHNLHEPMYYFLAMLAATDLG      1 - 70
VTLTTMPTVLGVLWLDHREIGHGACFSQAYFIHTLSVMESGVLLAMAYDCFITIRSPLRYTSILTNTQVM     71 - 140
KIGVRVLTRAGLSIMPIVVRLHWFPYCRSHVLSHAFCLHQDVIKLACADITFNRLYPVVVLFAMVLLDFL    141 - 210
IIFFSYILILKTVMGIGSGGERAKALNTCVSHICCILVFYVTVVCLTFIHRFGKHVPHVVHITMSYIHFL    211 - 280
FPPFMNPFIYSIKTKQIQSGILRLFSLPHSRA                                          281 - 312
//

Text Mined References (4)

PMID Year Title
20018918 2010 Fetal hemoglobin in sickle cell anemia: genome-wide association studies suggest a regulatory region in the 5' olfactory receptor gene cluster.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.