Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.58

Knowledge Summary

Patent (190)

TINX Plot

  Disease (3)

Gene RIF (1)

AA Sequence

MGLNKSASTFQLTGFPGMEKAHHWIFIPLLAAYISILLGNGTLLFLIRNDHNLHEPMYYFLAMLAATDLG      1 - 70
VTLTTMPTVLGVLWLDHREIGHGACFSQAYFIHTLSVMESGVLLAMAYDCFITIRSPLRYTSILTNTQVM     71 - 140
KIGVRVLTRAGLSIMPIVVRLHWFPYCRSHVLSHAFCLHQDVIKLACADITFNRLYPVVVLFAMVLLDFL    141 - 210
IIFFSYILILKTVMGIGSGGERAKALNTCVSHICCILVFYVTVVCLTFIHRFGKHVPHVVHITMSYIHFL    211 - 280
FPPFMNPFIYSIKTKQIQSGILRLFSLPHSRA                                          281 - 312
//

Text Mined References (4)

PMID Year Title