Property Summary

NCBI Gene PubMed Count 40
Grant Count 34
R01 Count 27
Funding $8,261,679.36
PubMed Score 283.13
PubTator Score 172.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26900324 These data suggest that lowering of PNN levels in epithelial cells results in dramatic transformation in the number and composition of splicing variants and that PNN plays a crucial role in the selection of which RNA isoforms differentiating cells produce.
25489234 PNN has an important role in alternative splicing of a specific subset of lncRNAs of the corneal epithelium.
23299472 ESRP1 and PNN modulate alternative splicing of a specific subset of target genes, but not general splicing events, in HCET cells to maintain or enhance epithelial characteristics.
23097096 Urinary desmosine level is an important biologoical marker, in patients treated with bilateral knee replacement and hydrocortison therapy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18086895 Corepressor CtBP and PNN/DRS differentially modulate transcription and splicing of the E-cadherin gene.
16430868 Pnn may play a general role in the control of the cellular amount of family SR proteins through down-regulation of its own expression
15542832 the interaction of Pnn with the corepressor CtBP1 may modulate repression of E-cadherin transcription by CtBP1
14517304 Pnn may participate, via its interaction with RNPS1, in mRNA metabolism in the nucleus, including mRNA splicing and export
More...

AA Sequence

MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGG      1 - 70
GPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATSKERTRRDLIQDQNMDEKGKQ     71 - 140
RNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLE    141 - 210
QKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINK    211 - 280
MEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAE    281 - 350
KEQEEEEQKQEMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETNRVESVEPSENE    351 - 420
ASKELEPEMEFEIEPDKECKSLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQS    421 - 490
QPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHPESKSKTKTRS    491 - 560
RSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSSE    561 - 630
SRSRSRGRGHNRDRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKR    631 - 700
SSRSERDRKSDRKDKRR                                                         701 - 717
//

Text Mined References (56)

PMID Year Title
26900324 2016 RNA-seq analysis of impact of PNN on gene expression and alternative splicing in corneal epithelial cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25489234 2014 Role of Pnn in alternative splicing of a specific subset of lncRNAs of the corneal epithelium.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23299472 2013 Transcriptomic analysis of PNN- and ESRP1-regulated alternative pre-mRNA splicing in human corneal epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097096 2012 Steroid modulation of cytokine release and desmosine levels in bilateral total knee replacement: a prospective, double-blind, randomized controlled trial.
More...