Property Summary

NCBI Gene PubMed Count 12
PubMed Score 36.00
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (4)

AA Sequence

MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPH      1 - 70
MSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQT     71 - 140
VCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC      141 - 208
//

Text Mined References (15)

PMID Year Title