Property Summary

NCBI Gene PubMed Count 12
PubMed Score 36.00
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H305 A8K7M1 B4DFU1 B4DY75 D3DUD6 Q96ID8 Q9H0Q4 Q9P112
Symbols I1
CDIP
LITAFL
C16orf5

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (4)

AA Sequence

MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPH      1 - 70
MSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQT     71 - 140
VCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC      141 - 208
//

Text Mined References (15)

PMID Year Title