Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 5.7e-25

Synonym

Accession Q9H2J1 Q17RM5 Q5T368
Symbols C9orf37

 Compartment GO Term (1)

AA Sequence

MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPS      1 - 70
SPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQG     71 - 140
PGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA                                      141 - 176
//

Text Mined References (4)

PMID Year Title