Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.89
PubTator Score 16.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cholestasis 155 4.006 2.0
Bile acid synthesis defect, congenital, 1 1 0.0 0.0
Disease Target Count P-value
Astrocytoma, Pilocytic 3081 2.5e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Congenital bile acid synthesis defect 15 3.117 1.6
Disease Target Count Z-score Confidence
Intrahepatic cholestasis 20 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.5e-07

Gene RIF (5)

AA Sequence

MADSAQAQKLVYLVTGGCGFLGEHVVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQA      1 - 70
HEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGH     71 - 140
PFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQGL    141 - 210
RLGGWLFRAIPASVEHGRVYVGNVAWMHVLAARELEQRATLMGGQVYFCYDGSPYRSYEDFNMEFLGPCG    211 - 280
LRLVGARPLLPYWLLVFLAALNALLQWLLRPLVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSW    281 - 350
EDSRTRTILWVQAATGSAQ                                                       351 - 369
//

Text Mined References (15)

PMID Year Title