Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.51
PubTator Score 0.78

Knowledge Summary

Patent (89)

TINX Plot

  Disease (4)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Malaria 160 0.0 3.0
Peripheral vascular disease 87 0.0 3.0
Disease Target Count Z-score Confidence
Thalassemia 53 3.703 1.9

AA Sequence

MFLSSRMITSVSPSTSTNSSFLLTGFSGMEQQYPWLSIPFSSIYAMVLLGNCMVLHVIWTEPSLHQPMFY      1 - 70
FLSMLALTDLCMGLSTVYTVLGILWGIIREISLDSCIAQSYFIHGLSFMESSVLLTMAFDRYIAICNPLR     71 - 140
YSSILTNSRIIKIGLTIIGRSFFFITPPIICLKFFNYCHFHILSHSFCLHQDLLRLACSDIRFNSYYALM    141 - 210
LVICILLLDAILILFSYILILKSVLAVASQEERHKLFQTCISHICAVLVFYIPIISLTMVHRFGKHLSPV    211 - 280
AHVLIGNIYILFPPLMNPIIYSVKTQQIHTRMLRLFSLKRY                                 281 - 321
//

Text Mined References (4)

PMID Year Title