Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.08
PubTator Score 1.58

Knowledge Summary

Patent (214)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Thalassemia 53 3.832 1.9

AA Sequence

MPTFNGSVFMPSAFILIGIPGLESVQCWIGIPFSAMYLIGVIGNSLILVIIKYENSLHIPMYIFLAMLAA      1 - 70
TDIALNTCILPKMLGIFWFHLPEISFDACLFQMWLIHSFQAIESGILLAMALDRYVAICIPLRHATIFSQ     71 - 140
QFLTHIGLGVTLRAAILIIPSLGLIKCCLKHYRTTVISHSYCEHMAIVKLATEDIRVNKIYGLFVAFAIL    141 - 210
GFDIIFITLSYVQIFITVFQLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHIPPYIHILLS    211 - 280
NLYLLVPPFLNPIVYGVKTKQIRDHIVKVFFFKKVT                                      281 - 316
//

Text Mined References (2)

PMID Year Title