Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.08
PubTator Score 1.58

Knowledge Summary

Patent (214)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Thalassemia 46 3.82 1.9

AA Sequence

MPTFNGSVFMPSAFILIGIPGLESVQCWIGIPFSAMYLIGVIGNSLILVIIKYENSLHIPMYIFLAMLAA      1 - 70
TDIALNTCILPKMLGIFWFHLPEISFDACLFQMWLIHSFQAIESGILLAMALDRYVAICIPLRHATIFSQ     71 - 140
QFLTHIGLGVTLRAAILIIPSLGLIKCCLKHYRTTVISHSYCEHMAIVKLATEDIRVNKIYGLFVAFAIL    141 - 210
GFDIIFITLSYVQIFITVFQLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHIPPYIHILLS    211 - 280
NLYLLVPPFLNPIVYGVKTKQIRDHIVKVFFFKKVT                                      281 - 316
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.