Property Summary

NCBI Gene PubMed Count 19
PubMed Score 44.44
PubTator Score 12.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -4.100 1.8e-06
astrocytic glioma -3.400 1.3e-03
Astrocytoma, Pilocytic -5.400 3.1e-15
atypical teratoid / rhabdoid tumor -3.900 1.4e-04
ependymoma -4.100 3.6e-03
glioblastoma -3.700 1.5e-08
lung carcinoma 4.900 1.0e-53
oligodendroglioma -1.800 3.4e-02
ovarian cancer -4.400 1.2e-16
Pick disease -1.800 1.6e-02
primitive neuroectodermal tumor -2.200 3.5e-02
subependymal giant cell astrocytoma -4.466 3.8e-02

Gene RIF (4)

AA Sequence

MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSK      1 - 70
KKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLK     71 - 140
SSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRV    141 - 210
LRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKR    211 - 280
NVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTP    281 - 350
NAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH    351 - 420
VLCDG                                                                     421 - 425
//

Text Mined References (21)

PMID Year Title