Property Summary

NCBI Gene PubMed Count 19
PubMed Score 44.01
PubTator Score 12.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung carcinoma 2844 1.02748427066482E-53
posterior fossa group A ependymoma 1511 6.62224120389532E-20
ovarian cancer 8492 1.15705387147704E-16
pilocytic astrocytoma 3086 1.5032916692565E-15
oligodendroglioma 2849 1.1208817646813E-10
adult high grade glioma 2148 1.76376114848675E-6
glioblastoma 5572 1.16697836556074E-4
atypical teratoid / rhabdoid tumor 4369 1.44460897334082E-4
astrocytic glioma 2241 0.00125450862639553
Pick disease 1893 0.0159420795358183
primitive neuroectodermal tumor 3031 0.0352473254366791
subependymal giant cell astrocytoma 2287 0.0377113258240585
Disease Target Count Z-score Confidence
Neuroaxonal dystrophy 7 3.62 1.8

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.400 0.001
posterior fossa group A ependymoma -4.700 0.000
oligodendroglioma -2.200 0.000
glioblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
primitive neuroectodermal tumor -2.200 0.035
adult high grade glioma -4.100 0.000
pilocytic astrocytoma -5.400 0.000
subependymal giant cell astrocytoma -4.466 0.038
lung carcinoma 4.900 0.000
Pick disease -1.800 0.016
ovarian cancer -4.400 0.000

Synonym

Accession Q9H2B2 B4DEU3 Q9P2K4
Symbols HsT1192

Gene

PDB

1UGK  

  Ortholog (12)

Gene RIF (4)

PMID Text
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
22082156 Knockdown of synaptotagmin IV (SYT4) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21315262 Synaptotagmin 4 negatively regulates oxytocin exocytosis, and dietary obesity is associated with increased synaptotagmin 4 binding to vesicles.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSK      1 - 70
KKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLK     71 - 140
SSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRV    141 - 210
LRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKR    211 - 280
NVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTP    281 - 350
NAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH    351 - 420
VLCDG                                                                     421 - 425
//

Text Mined References (21)

PMID Year Title
26750488 2016 Upregulation and axonal transport of synaptotagmin-IV in the direct-pathway medium spiny neurons in hemi-parkinsonian rats induced by dopamine D1 receptor stimulation.
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
25416956 2014 A proteome-scale map of the human interactome network.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
21315262 2011 Neuropeptide exocytosis involving synaptotagmin-4 and oxytocin in hypothalamic programming of body weight and energy balance.
21153436 2011 Synaptotagmin IV acts as a multi-functional regulator of Ca2+-dependent exocytosis.
20735850 2010 Upregulation of synaptotagmin IV inhibits transmitter release in PC12 cells with targeted synaptotagmin I knockdown.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...