Property Summary

NCBI Gene PubMed Count 13
Grant Count 78
R01 Count 64
Funding $7,260,262.38
PubMed Score 131.49
PubTator Score 53.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.000 0.000

Synonym

Accession Q9H2A3 Q8N416 NGN-2
Symbols NGN2
Atoh4
ngn-2
Math4A
bHLHa8

Gene

PANTHER Protein Class (2)

Gene RIF (8)

PMID Text
25912433 Study shows neurogenin 2 enhances the generation of patient-specific induced neuronal cells.
25403753 Results show that neurogenin-1 and -2 drive homogeneous differentiation of human stem cells into bipolar neurons in 4 days in defined media.
21209909 human embryonic progenitors expressing neurogenin-2 stimulate axonal sprouting and improve motor recovery after severe spinal cord injury
20332099 Observational study of gene-disease association. (HuGE Navigator)
19879328 Novel compound heterozygous variants (Gly56Arg and Asp206Glu) were found in a 91-year normal male, suggesting that mutations in the coding region of the NEUROG2 gene play little or no role in the development of PD.
19879328 Observational study of gene-disease association. (HuGE Navigator)
18242186 Rat and mouse species-dependent differences of Nurr1 and Ngn2 actions in dopamine neuron differentiation.
17784840 expression of Ngn2 during the differentiation of neuronl human embryo stem cells.

AA Sequence

MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAG      1 - 70
AEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLP     71 - 140
TFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSP    141 - 210
ASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI            211 - 272
//

Text Mined References (13)

PMID Year Title
25912433 2015 Neurogenin 2 enhances the generation of patient-specific induced neuronal cells.
25403753 2014 Rapid neurogenesis through transcriptional activation in human stem cells.
21209909 2010 Grafted human embryonic progenitors expressing neurogenin-2 stimulate axonal sprouting and improve motor recovery after severe spinal cord injury.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19879328 2010 Genetic analysis of the NEUROG2 gene in patients with Parkinson's disease.
18242186 2008 Proneural bHLH neurogenin 2 differentially regulates Nurr1-induced dopamine neuron differentiation in rat and mouse neural precursor cells in vitro.
17784840 2007 Neurospheres derived from human embryoid bodies treated with retinoic Acid show an increase in nestin and ngn2 expression that correlates with the proportion of tyrosine hydroxylase-positive cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752450 2001 neurogenin2 elicits the genesis of retinal neurons from cultures of nonneural cells.
More...