Property Summary

NCBI Gene PubMed Count 85
PubMed Score 151.01
PubTator Score 152.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.074 2.9e-03
adult high grade glioma 2.100 2.2e-04
Atopic dermatitis 1.100 6.2e-05
atypical teratoid / rhabdoid tumor 1.100 1.8e-03
Breast cancer 1.200 1.3e-09
glioblastoma 1.100 9.1e-05
group 3 medulloblastoma 1.400 1.0e-03
invasive ductal carcinoma 1.100 2.0e-03
lung adenocarcinoma 2.300 9.1e-10
malignant mesothelioma 2.100 1.7e-07
medulloblastoma, large-cell 1.800 2.9e-04
non-small cell lung cancer 1.317 1.1e-17
osteosarcoma -1.781 1.6e-03
ovarian cancer 2.300 4.4e-12
primitive neuroectodermal tumor 1.800 3.1e-03
psoriasis 1.300 6.7e-11

 MGI Phenotype (1)

Gene RIF (57)

AA Sequence

MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRL      1 - 70
RLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRAL     71 - 140
KASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNR    141 - 210
SETPTFAKVQRGVQDMMRRRFEECNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEAD    211 - 280
GAAPQLTASRLLQRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQ    281 - 350
PPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ    351 - 420
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIM    421 - 490
SPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL                  491 - 546
//

Text Mined References (91)

PMID Year Title