Property Summary

NCBI Gene PubMed Count 80
Grant Count 119
R01 Count 78
Funding $6,584,728.86
PubMed Score 139.24
PubTator Score 152.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
osteosarcoma -2.197 0.001
glioblastoma 2.300 0.000
medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 2.700 0.000
medulloblastoma, large-cell 3.400 0.000
primitive neuroectodermal tumor 1.800 0.003
Atopic dermatitis 1.100 0.000
adrenocortical carcinoma 1.185 0.007
non-small cell lung cancer 2.190 0.000
adult high grade glioma 2.100 0.000
lung adenocarcinoma 2.300 0.000
psoriasis 1.300 0.000
inflammatory breast cancer 1.400 0.015
invasive ductal carcinoma 1.100 0.002
ovarian cancer 2.300 0.000

Synonym

Accession Q9H211 Q86XX9 Q96CJ5 Q96GK5 Q96H67 Q96HE6 Q9BWM0
Symbols DUP
RIS2

Gene

PDB

2WVR   2LE8  

 GO Function (1)

 MGI Term (1)

Gene RIF (53)

PMID Text
24828503 FBXO31 interacts with Cdt1 and regulates the degradation of Cdt1 in G2 phase.
24280901 ATM silencing induced partial reduction in levels of Skp2, a component of SCF(Skp2) ubiquitin ligase that controls Cdt1 degradation.
23152514 These results demonstrate an important role for Cdt1 in human papillomavirus E7-induced rereplication and shed light on mechanisms by which human papillomavirus induces genomic instability.
23029527 ATR, activated after DNA damage, phosphorylates Cdt2 and promotes the rapid degradation of Cdt1 after UV irradiation in the G1 phase of the cell cycle.
22918581 Protein levels of Geminin and Cdt1 are tightly regulated through the cell cycle, and the Cdt1-Geminin complex likely acts as a molecular switch that can enable or disable the firing of each origin of replication.
22581055 results support the conclusion that Cdt1 binding to Hec1 is essential for an extended Ndc80 configuration and stable kinetochore-microtubule attachment
22560525 Genes in the erythroid differentiation and cell cycle regulation pathways influence interindividual variation in RBC indices. Our results provide insights into the molecular basis underlying variation in RBC traits.
22451935 FOXO3 is a binding partner of Cdt1.
22333897 A lethal phenotype was seen in four individuals with compound heterozygous CDT1 mutations
21981919 p97 is an essential regulator of DNA damage-dependent CDT1 destruction
More...

AA Sequence

MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRL      1 - 70
RLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRAL     71 - 140
KASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNR    141 - 210
SETPTFAKVQRGVQDMMRRRFEECNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEAD    211 - 280
GAAPQLTASRLLQRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQ    281 - 350
PPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ    351 - 420
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIM    421 - 490
SPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL                  491 - 546
//

Text Mined References (85)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24828503 2014 SCF-FBXO31 E3 ligase targets DNA replication factor Cdt1 for proteolysis in the G2 phase of cell cycle to prevent re-replication.
24280901 2014 ATM regulates Cdt1 stability during the unperturbed S phase to prevent re-replication.
24217620 2013 The histone demethylase LSD1/KDM1A promotes the DNA damage response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152514 2013 Human papillomavirus E7 induces rereplication in response to DNA damage.
23029527 2012 Checkpoint kinase ATR phosphorylates Cdt2, a substrate receptor of CRL4 ubiquitin ligase, and promotes the degradation of Cdt1 following UV irradiation.
22918581 2012 Cdt1 and geminin in DNA replication initiation.
22645314 2012 Dynamic association of ORCA with prereplicative complex components regulates DNA replication initiation.
More...