Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.23
PubTator Score 1.36

Knowledge Summary

Patent (3,375)

TINX Plot

  Disease (1)

AA Sequence

MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPMYFFLRNLSFL      1 - 70
EIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYPVIMNQR     71 - 140
TRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLKLVCADTALFEIYAIVGTILVVMI    141 - 210
PCLLILCSYTRIAAAILKIPSAKGKHKAFSTCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYT    211 - 280
VVTPMLNPIIYSLRNSEVKNALSRTFHKVLALRNCIP                                     281 - 317
//

Text Mined References (7)

PMID Year Title