Property Summary

NCBI Gene PubMed Count 31
Grant Count 2
Funding $118,397
PubMed Score 47.22
PubTator Score 40.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
26823803 low expression or no expression of ECRG4 in esophageal cancer tissues was closely related to the degree of tumor invasion level, TNM staging, lymph node metastasis and recurrence and survival after surgery.
26631111 loss of ECRG4 protein expression may be involved in tumor progression and may serve as a prognostic biomarker for breast cancer.
26165988 Overexpression of ECRG4 inhibited laryngeal cancer cell proliferation and induced cancer cell apoptosis.
25707757 Our data suggest that methylation-mediated suppression of the ECRG4 gene occurs frequently in nasopharyngeal carcinoma
25511108 ECRG4 is present on the surface of human monocytes and granulocytes and its interaction with the innate immunity receptor complex supports a role for cell surface activation of ECRG4 during inflammation
25378632 Results identify Ecrg4 as a paracrine factor that activates microglia and is chemotactic for monocytes, with potential as an antitumor therapeutic.
25326809 The expression of ECRG4 is frequently upregulated in a papillary thyroid carcinoma through the demethylation mechanism of CpG islands in the gene promoter region, and the ECRG4 has a tumor-promoting function through inducing the cell cycle transition
23957914 ECRG4 is a candidate tumor suppressor gene that might be involved in the proliferation of esophageal squamous cell carcinoma
23770814 results suggest that C2ORF40 acts as a tumor suppressor gene in breast cancer pathogenesis and progression and is a candidate prognostic marker for this disease
23553029 overexpression of ECRG4 enhanced the chemosensitivity of gastric cancer SGC-7901 cells to 5-FU through induction of apoptosis.
More...

AA Sequence

MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR      1 - 70
QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG     71 - 140
ASVNYDDY                                                                  141 - 148
//

Text Mined References (31)

PMID Year Title
26823803 2015 Expression of esophageal carcinoma related gene 4 (ECRG4) and its clinical significance in prognosis of esophageal carcinoma.
26631111 2016 Down-regulated ECRG4 expression in breast cancer and its correlation with tumor progression and poor prognosis--A short Report.
26165988 2015 A preliminary study of the effect of ECRG4 overexpression on the proliferation and apoptosis of human laryngeal cancer cells and the underlying mechanisms.
25707757 2015 ECRG4 acts as a tumor suppressor and as a determinant of chemotherapy resistance in human nasopharyngeal carcinoma.
25511108 2015 Esophageal cancer-related gene-4 (ECRG4) interactions with the innate immunity receptor complex.
25378632 2015 Thrombin-processed Ecrg4 recruits myeloid cells and induces antitumorigenic inflammation.
25326809 2015 The tumor-promoting function of ECRG4 in papillary thyroid carcinoma and its related mechanism.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23957914 2013 Expression of ECRG4 is associated with lower proliferative potential of esophageal cancer cells.
23770814 2013 C2ORF40 suppresses breast cancer cell proliferation and invasion through modulating expression of M phase cell cycle genes.
More...