Property Summary

NCBI Gene PubMed Count 9
PubMed Score 22.10
PubTator Score 6.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.100 6.9e-05
astrocytic glioma -1.200 4.0e-02
Astrocytoma, Pilocytic -1.800 8.9e-07
atypical teratoid / rhabdoid tumor -2.800 9.5e-08
diabetes mellitus -1.500 1.2e-03
ependymoma -2.000 2.2e-02
glioblastoma -2.000 1.2e-08
group 4 medulloblastoma -1.600 4.5e-04
medulloblastoma, large-cell -2.400 1.7e-04
oligodendroglioma -1.200 3.3e-02
osteosarcoma -1.162 3.4e-04
ovarian cancer 1.500 2.9e-04
primitive neuroectodermal tumor -1.700 2.4e-03

AA Sequence

MAAVWQQVLAVDARYNAYRTPTFPQFRTQYIRRRSQLLRENAKAGHPPALRRQYLRLRGQLLGQRYGPLS      1 - 70
EPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTS     71 - 140
AAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVL    141 - 210
RVLRGHTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPDSAELLCCTFQPVNNNLTVVGN    211 - 280
AKHNVHVMNISTGKKVKGGSSKLTGRVLALSFDAPGRLLWAGDDHGSVFSFLFDMATGKLTKAKRLVVHE    281 - 350
GSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ    351 - 420
GACVVTGSEDMCVHFFDVERAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRREQK         421 - 485
//

Text Mined References (15)

PMID Year Title