Property Summary

NCBI Gene PubMed Count 24
PubMed Score 20.13
PubTator Score 13.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 6.2e-05
atypical teratoid / rhabdoid tumor -1.100 2.3e-06
intraductal papillary-mucinous carcinoma... 1.300 3.9e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.1e-03
lung cancer -1.100 5.3e-03
malignant mesothelioma 1.200 2.1e-06
medulloblastoma, large-cell -1.300 4.0e-03
osteosarcoma -2.650 1.3e-07
ovarian cancer 1.100 1.5e-03
psoriasis -1.700 6.8e-05
subependymal giant cell astrocytoma -1.092 2.7e-02

Gene RIF (9)

AA Sequence

MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFS      1 - 70
RSDFSVWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSA     71 - 140
VASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKS    141 - 210
VEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKEL    211 - 280
HKVEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVA    281 - 350
QETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLAS    351 - 420
QEKERLEEKQREARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY              421 - 480
//

Text Mined References (28)

PMID Year Title