Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.44

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H1M0 D3DUX4 Q8WVL6 Q9NXP2
Symbols

Gene

PANTHER Protein Class (1)

AA Sequence

MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVSVVATP      1 - 70
VMTYGHLEGLINEWNLELEDQEKYFLLQATQVNAWDHTLIENGEMIRILHGEVNKVKLDQKRLEQELDFI     71 - 140
LSQQQELEFLLTYLEESTRDQSGLHYLQDADEEHVEISTRSAEF                              141 - 184
//

Text Mined References (9)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.