Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.58
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.65425771451763E-10
psoriasis 6685 4.89756481874152E-9
adult high grade glioma 2148 7.72326114455634E-4
medulloblastoma, large-cell 6234 8.11554644612803E-4
non primary Sjogren syndrome sicca 840 0.0139743400941502
Disease Target Count Z-score Confidence
Azoospermia 89 3.657 1.8

AA Sequence

MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE      1 - 70
EEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSP     71 - 140
QKILRPGQ                                                                  141 - 148
//

Text Mined References (4)

PMID Year Title
18703587 2008 A novel CHHC Zn-finger domain found in spliceosomal proteins and tRNA modifying enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.