Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.58
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Azoospermia 110 3.663 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 7.7e-04
medulloblastoma, large-cell 1.100 8.1e-04
non primary Sjogren syndrome sicca 1.100 1.4e-02
ovarian cancer 1.500 1.7e-10
psoriasis 2.400 4.9e-09

AA Sequence

MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE      1 - 70
EEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSP     71 - 140
QKILRPGQ                                                                  141 - 148
//

Text Mined References (4)

PMID Year Title