Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.58
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H1H1 Q5JWH5
Symbols FAM112A
C20orf65
dJ1028D15.4

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE      1 - 70
EEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSP     71 - 140
QKILRPGQ                                                                  141 - 148
//

Text Mined References (4)

PMID Year Title
18703587 2008 A novel CHHC Zn-finger domain found in spliceosomal proteins and tRNA modifying enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.