Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H1C7 Q8TBA5
Symbols C5orf32
ORF1-FL49

Gene

AA Sequence

MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQR      1 - 70
RDELGPSTCLTACWTALCCCCLWDMLT                                                71 - 97
//

Text Mined References (9)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19933165 2010 CYSTM, a novel cysteine-rich transmembrane module with a role in stress tolerance across eukaryotes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.