Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9H1C7 Q8TBA5
Symbols C5orf32
ORF1-FL49

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

AA Sequence

MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQR      1 - 70
RDELGPSTCLTACWTALCCCCLWDMLT                                                71 - 97
//

Text Mined References (9)

PMID Year Title