Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.85
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVASAASALKDVS      1 - 70
YKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDII     71 - 140
LNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWELGKVKGLK    141 - 210
LEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHL    211 - 280
VLQFLQQSNLCKYFKDSRNIKILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTC    281 - 350
FLPRAGPESQRWWCLLSLKWKDGLRVLILPSCGPSSLPLAAIPVCAS                           351 - 397
//

Text Mined References (10)

PMID Year Title