Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.42
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5792 4.2e-05
osteosarcoma 7950 1.4e-04
ovarian cancer 8520 3.8e-04
group 4 medulloblastoma 1855 1.9e-03
adult high grade glioma 3801 3.8e-03
lung cancer 4740 4.2e-03
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 3.013 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 3.8e-03
glioblastoma -1.500 4.2e-05
group 4 medulloblastoma -1.200 1.9e-03
lung cancer 1.100 4.2e-03
osteosarcoma -2.025 1.4e-04
ovarian cancer -1.500 3.8e-04

Synonym

Accession Q9H1A3 Q8NBT8 Q9BWJ7 Q9H1A2 Q9Y390
Symbols DREV
PAP1
DREV1
CGI-81

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQA      1 - 70
VFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKI     71 - 140
NPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLN    141 - 210
LLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVF    211 - 280
RKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV                                    281 - 318
//

Text Mined References (13)

PMID Year Title