Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.42
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.025 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.200 0.000
lung cancer 1.300 0.000
adult high grade glioma -1.200 0.004
ovarian cancer -1.500 0.000

Synonym

Accession Q9H1A3 Q8NBT8 Q9BWJ7 Q9H1A2 Q9Y390
Symbols DREV
PAP1
DREV1
CGI-81

Gene

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
16837177 cloned the PAP1 gene, a p53 activated protein, from a U251-pTet-p53 cell line which carried a wild-type p53 transgene.

AA Sequence

MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQA      1 - 70
VFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKI     71 - 140
NPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLN    141 - 210
LLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVF    211 - 280
RKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV                                    281 - 318
//

Text Mined References (13)

PMID Year Title
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16837177 2006 Characterization of the human PAP1 gene and its homologue possible involvement in mouse embryonic development.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16413759 2006 Effects of exogenous p53 transfection on the gene expression in the human brain glioma cell line U251.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
More...