Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.04
PubTator Score 7.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.45403123231575E-17
colon cancer 1475 3.0075111862297E-12
lung adenocarcinoma 2714 9.72351095181078E-9
adrenocortical carcinoma 1427 7.67932229508441E-8
psoriasis 6685 7.85554657629191E-8
posterior fossa group A ependymoma 1511 1.08582119849301E-7
ovarian cancer 8492 7.23297521439077E-5
adrenocortical adenoma 134 4.35333143370206E-4
group 4 medulloblastoma 1875 6.77383736793039E-4
pilocytic astrocytoma 3086 9.48665300907921E-4
atypical teratoid/rhabdoid tumor 1095 0.00107826232826743
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00126620238918992
interstitial cystitis 2299 0.00168713518707075
Down syndrome 548 0.00214893939558867
Pick disease 1893 0.00307308178660641
Breast cancer 3099 0.00363704006767347
lung cancer 4473 0.00518017595731202
progressive supranuclear palsy 674 0.0103380682728293
oligodendroglioma 2849 0.0117395055383065
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0182894381165564
astrocytic glioma 2241 0.0436674499997323
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
CHARGE syndrome 23 3.013 1.5

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.000 0.044
posterior fossa group A ependymoma -1.900 0.000
oligodendroglioma -1.300 0.012
psoriasis -1.400 0.000
group 4 medulloblastoma -2.300 0.001
adrenocortical adenoma -1.635 0.000
adrenocortical carcinoma -1.706 0.000
non-small cell lung cancer -1.281 0.000
intraductal papillary-mucinous adenoma (... -2.400 0.001
intraductal papillary-mucinous carcinoma... -2.200 0.018
colon cancer -4.200 0.000
lung cancer -1.700 0.005
interstitial cystitis 2.200 0.002
lung adenocarcinoma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.700 0.001
pilocytic astrocytoma 3.300 0.001
Pick disease -1.200 0.003
progressive supranuclear palsy -1.900 0.010
Breast cancer -1.300 0.004
ovarian cancer -1.800 0.000
Down syndrome 1.600 0.002

Synonym

Accession Q9H159 B4E1V5 F5H1K0
Symbols CDH7
CDH7L2

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
25361488 Gene expression profiling of Glioblastoma stem-like cells has shown CDH19 to be an exciting new target for drug development and study of glioblastoma multiforme tumorigenesis

AA Sequence

MNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQLRSDL      1 - 70
DNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSD     71 - 140
INDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISS    141 - 210
KMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMA    211 - 280
YDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHT    281 - 350
EASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG    351 - 420
TITTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQT    421 - 490
ISAVDRDESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNRTGFNLQEEPVFYISILIADNGIPSL    491 - 560
TSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFKTEVIIAILICIMIIFGFIFLTLGLKQRRKQILFPEK    561 - 630
SEDFRENIFQYDDEGGGEEDTEAFDIAELRSSTIMRERKTRKTTSAEIRSLYRQSLQVGPDSAIFRKFIL    631 - 700
EKLEEANTDPCAPPFDSLQTYAFEGTGSLAGSLSSLESAVSDQDESYDYLNELGPRFKRLACMFGSAVQS    701 - 770
NN                                                                        771 - 772
//

Text Mined References (13)

PMID Year Title
25361488 2015 Myelin-forming cell-specific cadherin-19 is a marker for minimally infiltrative glioblastoma stem-like cells.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
20358601 2010 A maternally inherited chromosome 18q22.1 deletion in a male with late-presenting diaphragmatic hernia and microphthalmia-evaluation of DSEL as a candidate gene for the diaphragmatic defect.
18364357 2008 Monocyte chemotactic protein (MCP)-1 promotes angiogenesis via a novel transcription factor, MCP-1-induced protein (MCPIP).
18184143 2008 A novel locus for ectodermal dysplasia of hairs, nails and teeth type maps to chromosome 18q22.1-22.3.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118382 2002 Delineation and candidate gene mutation screening of the 18q22 minimal region of deletion in head and neck squamous cell carcinoma.
More...