Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.04
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.000 0.044
posterior fossa group A ependymoma -1.900 0.000
oligodendroglioma -1.300 0.012
psoriasis -1.400 0.000
group 4 medulloblastoma -2.300 0.001
adrenocortical adenoma -1.635 0.000
adrenocortical carcinoma -1.706 0.000
non-small cell lung cancer -1.281 0.000
intraductal papillary-mucinous adenoma (... -2.400 0.001
intraductal papillary-mucinous carcinoma... -2.200 0.018
colon cancer -4.200 0.000
lung cancer -1.700 0.005
interstitial cystitis 2.200 0.002
lung adenocarcinoma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.700 0.001
pilocytic astrocytoma 3.300 0.001
Pick disease -1.200 0.003
progressive supranuclear palsy -1.900 0.010
Breast cancer -1.300 0.004
ovarian cancer -1.800 0.000
Down syndrome 1.600 0.002

Gene RIF (1)

PMID Text
25361488 Gene expression profiling of Glioblastoma stem-like cells has shown CDH19 to be an exciting new target for drug development and study of glioblastoma multiforme tumorigenesis

AA Sequence

MNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQLRSDL      1 - 70
DNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSD     71 - 140
INDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISS    141 - 210
KMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMA    211 - 280
YDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHT    281 - 350
EASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG    351 - 420
TITTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQT    421 - 490
ISAVDRDESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNRTGFNLQEEPVFYISILIADNGIPSL    491 - 560
TSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFKTEVIIAILICIMIIFGFIFLTLGLKQRRKQILFPEK    561 - 630
SEDFRENIFQYDDEGGGEEDTEAFDIAELRSSTIMRERKTRKTTSAEIRSLYRQSLQVGPDSAIFRKFIL    631 - 700
EKLEEANTDPCAPPFDSLQTYAFEGTGSLAGSLSSLESAVSDQDESYDYLNELGPRFKRLACMFGSAVQS    701 - 770
NN                                                                        771 - 772
//

Text Mined References (13)

PMID Year Title
25361488 2015 Myelin-forming cell-specific cadherin-19 is a marker for minimally infiltrative glioblastoma stem-like cells.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
20358601 2010 A maternally inherited chromosome 18q22.1 deletion in a male with late-presenting diaphragmatic hernia and microphthalmia-evaluation of DSEL as a candidate gene for the diaphragmatic defect.
18364357 2008 Monocyte chemotactic protein (MCP)-1 promotes angiogenesis via a novel transcription factor, MCP-1-induced protein (MCPIP).
18184143 2008 A novel locus for ectodermal dysplasia of hairs, nails and teeth type maps to chromosome 18q22.1-22.3.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118382 2002 Delineation and candidate gene mutation screening of the 18q22 minimal region of deletion in head and neck squamous cell carcinoma.
More...