Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.17
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical adenoma -1.635 4.4e-04
adrenocortical carcinoma -1.706 7.7e-08
astrocytic glioma -2.000 4.4e-02
Astrocytoma, Pilocytic 2.400 5.0e-04
atypical teratoid/rhabdoid tumor -1.700 1.1e-03
Breast cancer -1.300 3.6e-03
colon cancer -2.000 1.2e-02
Down syndrome 1.600 2.1e-03
ependymoma -1.300 2.4e-02
group 3 medulloblastoma -2.000 2.3e-02
interstitial cystitis 2.100 3.3e-03
intraductal papillary-mucinous adenoma (... -2.400 1.3e-03
intraductal papillary-mucinous carcinoma... -2.200 1.8e-02
lung adenocarcinoma -1.100 3.5e-16
lung cancer -1.700 5.2e-03
non-small cell lung cancer -1.281 3.5e-17
oligodendroglioma -1.300 1.2e-02
ovarian cancer 1.300 1.1e-05
Pick disease -1.200 3.1e-03
progressive supranuclear palsy -1.900 1.0e-02
psoriasis -1.400 7.9e-08

Gene RIF (1)

AA Sequence

MNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQLRSDL      1 - 70
DNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSD     71 - 140
INDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISS    141 - 210
KMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMA    211 - 280
YDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHT    281 - 350
EASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG    351 - 420
TITTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQT    421 - 490
ISAVDRDESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNRTGFNLQEEPVFYISILIADNGIPSL    491 - 560
TSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFKTEVIIAILICIMIIFGFIFLTLGLKQRRKQILFPEK    561 - 630
SEDFRENIFQYDDEGGGEEDTEAFDIAELRSSTIMRERKTRKTTSAEIRSLYRQSLQVGPDSAIFRKFIL    631 - 700
EKLEEANTDPCAPPFDSLQTYAFEGTGSLAGSLSSLESAVSDQDESYDYLNELGPRFKRLACMFGSAVQS    701 - 770
NN                                                                        771 - 772
//

Text Mined References (13)

PMID Year Title