Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.17
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGIGCWRNPLLLLIALVLSAKLGHFQRWEGFQQKLMSKKNMNSTLNFFIQSYNNASNDTYLYRVQRLIRS      1 - 70
QMQLTTGVEYIVTVKIGWTKCKRNDTSNSSCPLQSKKLRKSLICESLIYTMPWINYFQLWNNSCLEAEHV     71 - 140
GRNLR                                                                     141 - 145
//

Text Mined References (9)

PMID Year Title