Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.46
PubTator Score 3.00

Knowledge Summary

Patent

No data available

AA Sequence

MGIGCWRNPLLLLIALVLSAKLGHFQRWEGFQQKLMSKKNMNSTLNFFIQSYNNASNDTYLYRVQRLIRS      1 - 70
QMQLTTGVEYIVTVKIGWTKCKRNDTSNSSCPLQSKKLRKSLICESLIYTMPWINYFQLWNNSCLEAEHV     71 - 140
GRNLR                                                                     141 - 145
//

Text Mined References (9)

PMID Year Title
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8179826 1994 The human type 2 cystatin gene family consists of eight to nine members, with at least seven genes clustered at a single locus on human chromosome 20.
7896273 1994 Direct mapping of seven genes encoding human type 2 cystatins to a single site located at 20p11.2.
7690606 1993 Genomic cloning, physical mapping, and expression of human type 2 cystatin genes.
3202964 1988 Cystatin superfamily. Evidence that family II cystatin genes are evolutionarily related to family III cystatin genes.