Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.33
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -3.720 7.2e-09
gastric cancer 1.100 7.6e-03
group 4 medulloblastoma 1.800 1.7e-04
hepatocellular carcinoma 1.200 4.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 8.6e-03
nasopharyngeal carcinoma 1.200 8.8e-03
osteosarcoma -1.096 3.1e-03
psoriasis 1.500 8.3e-14
sarcoidosis 1.200 4.6e-03
spina bifida -1.916 3.6e-02
tuberculosis -1.900 1.4e-04

AA Sequence

MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRR      1 - 70
LKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIK     71 - 140
LEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQ    141 - 210
QDKTLLSLNLKQTKSTFI                                                        211 - 228
//

Text Mined References (12)

PMID Year Title