Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.83
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.100 0.008
hepatocellular carcinoma 1.200 0.000
osteosarcoma -1.096 0.003
group 4 medulloblastoma 1.800 0.000
adrenocortical carcinoma -3.720 0.000
tuberculosis -1.900 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.009
sarcoidosis 1.200 0.005
nasopharyngeal carcinoma 1.200 0.009
psoriasis 1.500 0.000
spina bifida -1.916 0.036

AA Sequence

MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRR      1 - 70
LKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIK     71 - 140
LEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQ    141 - 210
QDKTLLSLNLKQTKSTFI                                                        211 - 228
//

Text Mined References (12)

PMID Year Title
22566634 2012 The genetic architecture of economic and political preferences.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...