Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.65
PubTator Score 7.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.77028650085658E-20
lung carcinoma 2844 5.17773740960523E-19
juvenile dermatomyositis 1189 8.67562369793169E-14
astrocytoma 1493 2.5596718660246E-9
posterior fossa group A ependymoma 1511 4.51898980166881E-6
non-small cell lung cancer 2798 3.96214381546658E-5
pilocytic astrocytoma 3086 8.66671010512172E-5
hepatocellular carcinoma 550 1.22978533323647E-4
ovarian cancer 8492 0.00200785205425715
pancreatic cancer 2300 0.00416807106592941
adult high grade glioma 2148 0.00449763715897964
subependymal giant cell astrocytoma 2287 0.00460180601653558
primary Sjogren syndrome 789 0.00769862453535116
pituitary cancer 1972 0.00790135226909409
glioblastoma 5572 0.0116460166318726
primary pancreatic ductal adenocarcinoma 1271 0.0261710382607279
Disease Target Count Z-score Confidence
Hypoglycemic coma 1 3.401 1.7

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
astrocytoma 2.000 0.000
glioblastoma 2.500 0.012
posterior fossa group A ependymoma 3.000 0.000
juvenile dermatomyositis 2.902 0.000
primary pancreatic ductal adenocarcinoma 1.968 0.026
non-small cell lung cancer -1.371 0.000
pancreatic cancer 1.200 0.004
adult high grade glioma 2.600 0.004
pilocytic astrocytoma 3.100 0.000
primary Sjogren syndrome 1.400 0.008
subependymal giant cell astrocytoma 3.357 0.005
lung carcinoma -2.500 0.000
ovarian cancer -2.500 0.002
pituitary cancer -1.800 0.008
psoriasis 1.300 0.000

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (2)

PMID Text
22106366 Data show that the novel splice variant of guanylate binding protein 3 hGBP-3, named hGBP-3DeltaC, showed the most prominent antiviral activity in epithelial cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSLGST      1 - 70
VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAVLLSSTLVYNSMGTINQQAMD     71 - 140
QLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLEYSLKLTQGT    141 - 210
SQKDKNFNLPRLCIRKFFPKKKCFVFDLPIHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL    211 - 280
SGGIKVNGPRLESLVLTYINAISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQE    281 - 350
LLDLHRVSEREATEVYMKNSFKDVDHLFQKKLAAQLDKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEV    351 - 420
KAGIYSKPGGYCLFIQKLQDLEKKYYEEPRKGIQAEEILQTYLKSKESVTDAILQTDQILTEKEKEIEVE    421 - 490
CVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQLTEKMERERAQLLEEQEKTLTSKLQEQARVLK    491 - 560
ERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI                                       561 - 595
//

Text Mined References (13)

PMID Year Title
22106366 2012 A new splice variant of the human guanylate-binding protein 3 mediates anti-influenza activity through inhibition of viral transcription and replication.
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387898 2002 A novel GTP-binding protein hGBP3 interacts with NIK/HGK.
More...