Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.65
PubTator Score 7.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
astrocytoma 2.000 0.000
glioblastoma 2.500 0.012
posterior fossa group A ependymoma 3.000 0.000
juvenile dermatomyositis 2.902 0.000
primary pancreatic ductal adenocarcinoma 1.968 0.026
non-small cell lung cancer -1.371 0.000
pancreatic cancer 1.200 0.004
adult high grade glioma 2.600 0.004
pilocytic astrocytoma 3.100 0.000
primary Sjogren syndrome 1.400 0.008
subependymal giant cell astrocytoma 3.357 0.005
lung carcinoma -2.500 0.000
ovarian cancer -2.500 0.002
pituitary cancer -1.800 0.008
psoriasis 1.300 0.000

Gene RIF (2)

PMID Text
22106366 Data show that the novel splice variant of guanylate binding protein 3 hGBP-3, named hGBP-3DeltaC, showed the most prominent antiviral activity in epithelial cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSLGST      1 - 70
VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAVLLSSTLVYNSMGTINQQAMD     71 - 140
QLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLEYSLKLTQGT    141 - 210
SQKDKNFNLPRLCIRKFFPKKKCFVFDLPIHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL    211 - 280
SGGIKVNGPRLESLVLTYINAISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQE    281 - 350
LLDLHRVSEREATEVYMKNSFKDVDHLFQKKLAAQLDKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEV    351 - 420
KAGIYSKPGGYCLFIQKLQDLEKKYYEEPRKGIQAEEILQTYLKSKESVTDAILQTDQILTEKEKEIEVE    421 - 490
CVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQLTEKMERERAQLLEEQEKTLTSKLQEQARVLK    491 - 560
ERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI                                       561 - 595
//

Text Mined References (13)

PMID Year Title
22106366 2012 A new splice variant of the human guanylate-binding protein 3 mediates anti-influenza activity through inhibition of viral transcription and replication.
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387898 2002 A novel GTP-binding protein hGBP3 interacts with NIK/HGK.
More...