Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.59
PubTator Score 5.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Alzheimer's disease 644 3.519 1.8

Expression

Gene RIF (2)

PMID Text
26919393 PILRB and GATS expression levels, within the ZCWPW1 locus, were associated with Alzheimer's disease status.
24743338 Of those 394 variants, 34 showed strong evidence of regulatory function (RegulomeDB score <3), and only 3 of them were genome-wide significant SNPs (ZCWPW1/rs1476679, CLU/rs1532278 and ABCA7/rs3764650).

AA Sequence

MMTTLQNKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASLKKKEEKATMK      1 - 70
NVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKSLQECLGMGSGLDFAETSCAQPVVST     71 - 140
QSDKEPGITASATDTDNANGEEVPHTQEISVSWEGEAAPEIRTSKLGQPDPAPSKKKSNRLTLSKRKKEA    141 - 210
HEKVEKTQGGHEHRQEDRLKKTVQDHSQIRDQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLP    211 - 280
DNWSCDQNTDVQYNRCDIPEETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSH    281 - 350
LDSLPSKYHVTFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERV    351 - 420
NLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPR    421 - 490
GLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPPAPRMGRKEGQGNSDSDQPGPKKKFKAPQSKALAASFS    491 - 560
EGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGE    561 - 630
LQHSNSDGEDFPVALFGK                                                        631 - 648
//

Text Mined References (12)

PMID Year Title
26919393 2016 Alzheimer's Disease Risk Polymorphisms Regulate Gene Expression in the ZCWPW1 and the CELF1 Loci.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24743338 2014 Connecting the dots: potential of data integration to identify regulatory SNPs in late-onset Alzheimer's disease GWAS findings.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
20826339 2010 Structural insight into the zinc finger CW domain as a histone modification reader.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607086 2003 The CW domain, a structural module shared amongst vertebrates, vertebrate-infecting parasites and higher plants.
12853948 2003 The DNA sequence of human chromosome 7.
More...