Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.16
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.372 0.005
malignant mesothelioma 1.100 0.000
group 4 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.500 0.000
spina bifida -1.044 0.023
ovarian cancer -2.100 0.000

Gene

PDB

4V3K   4V3L   1X4J  

Gene RIF (2)

PMID Text
23973461 These results suggest RNF38 is an E3 ubiquitin ligase that may play a role in regulating p53.
12074600 Cloning and characterization of the RNF38 gene

AA Sequence

MACKISPGANSASLPGHPNKVICERVRLQSLFPLLPSDQNTTVQEDAHFKAFFQSEDSPSPKRQRLSHSV      1 - 70
FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSPPVRRQRGRRDRLSRHNSISQ     71 - 140
DENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGI    141 - 210
PLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLS    211 - 280
PHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPLQFLTHDPLH    281 - 350
QEVSFGVPYPPFMPRRLTGRSRYRSQQPIPPPPYHPSLLPYVLSMLPVPPAVGPTFSFELDVEDGEVENY    351 - 420
EALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCV    421 - 490
DKWLKANRTCPICRADASEVHRDSE                                                 491 - 515
//

Text Mined References (13)

PMID Year Title
23973461 2013 RNF38 encodes a nuclear ubiquitin protein ligase that modifies p53.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12074600 2002 Cloning and characterization of a novel human gene RNF38 encoding a conserved putative protein with a RING finger domain.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
More...