Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.96
PubTator Score 2.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.6e-05
glioblastoma 1.500 1.9e-04
group 4 medulloblastoma 2.000 4.7e-05
malignant mesothelioma 1.100 4.2e-05
medulloblastoma, large-cell 1.500 5.3e-06
Multiple myeloma 1.372 5.2e-03
ovarian cancer -2.100 4.7e-08
spina bifida -1.044 2.3e-02

Gene RIF (2)

AA Sequence

MACKISPGANSASLPGHPNKVICERVRLQSLFPLLPSDQNTTVQEDAHFKAFFQSEDSPSPKRQRLSHSV      1 - 70
FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSPPVRRQRGRRDRLSRHNSISQ     71 - 140
DENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGI    141 - 210
PLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLS    211 - 280
PHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPLQFLTHDPLH    281 - 350
QEVSFGVPYPPFMPRRLTGRSRYRSQQPIPPPPYHPSLLPYVLSMLPVPPAVGPTFSFELDVEDGEVENY    351 - 420
EALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCV    421 - 490
DKWLKANRTCPICRADASEVHRDSE                                                 491 - 515
//

Text Mined References (13)

PMID Year Title