Property Summary

NCBI Gene PubMed Count 29
Grant Count 7
R01 Count 3
Funding $2,298,880.66
PubMed Score 14.68
PubTator Score 249.89

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26624800 Our data suggest that CRISPLD2 may have a unique anti-HMGB1 effect via miRNA155 and play an important role in immune balance.
25496823 Results demonstrate genetic polymorphism of CRISPLD2 gene is associated with an increased risk of non-syndromic cleft lip with or without cleft palate.
25480331 findings define a role for LGL1 in fibroblast expansion and migration, epithelial cell migration, and mesenchymal-epithelial signaling, key processes in fetal lung development.
24955763 CRISPLD2 is a target of progesterone receptor and its expression is decreased in women with endometriosis.
24090571 Both LCCL-domains of human CRISPLD2 have high affinity for lipid A.
23799041 There is a decreased expression of CRISPLD2 in septic shock and it is association with procalcitonin in sepsis.
21800413 CRISPLD2 gene contributes to the etiology of NSCLP in the Northwestern Chinese population. SNP rs1546124 is significantly related to NSCLP, associated with both CL/P and CPO groups, and SNP rs4783099 is significantly associated with CPO.
21254358 These novel findings suggest that CRISPLD1 plays a role in Nonsyndromic cleft lip and palate (NSCLP) through the interaction with CRISPLD2 and folate pathway genes.
21244519 the present investigation did not support the hypothesis of the involvement of CRISPLD2 in nonsyndromic cleft lip and palate
20815724 results support the hypothesis that variants in the CRISPLD2 gene may be involved in the etiology of NS CL(P).
More...

AA Sequence

MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQV      1 - 70
QPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTY     71 - 140
PYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEA    141 - 210
PYKNGRPCSECPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSA    211 - 280
VNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDI    281 - 350
TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE    351 - 420
PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSESLGTPRDGKAF    421 - 490
RIFAVRQ                                                                   491 - 497
//

Text Mined References (30)

PMID Year Title
27597766 2016 CRISPLD2 (LGL1) inhibits proinflammatory mediators in human fetal, adult, and COPD lung fibroblasts and epithelial cells.
26624800 2016 HMGB1 induced inflammatory effect is blocked by CRISPLD2 via MiR155 in hepatic fibrogenesis.
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
25496823 2015 Preliminary evidence of an interaction between the CRISPLD2 gene and non-syndromic cleft lip with or without cleft palate (nsCL/P) in Xinjiang Uyghur population, China.
25480331 2015 LGL1 modulates proliferation, apoptosis, and migration of human fetal lung fibroblasts.
24955763 2014 CRISPLD2 is a target of progesterone receptor and its expression is decreased in women with endometriosis.
24090571 2014 Both LCCL-domains of human CRISPLD2 have high affinity for lipid A.
23799041 2013 CRISPLD2 is expressed at low levels during septic shock and is associated with procalcitonin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21800413 2011 The CRISPLD2 gene is involved in cleft lip and/or cleft palate in a Chinese population.
More...