Property Summary

NCBI Gene PubMed Count 29
PubMed Score 15.41
PubTator Score 249.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical adenoma -1.178 2.1e-02
adrenocortical carcinoma -2.092 4.2e-05
Astrocytoma, Pilocytic 1.400 1.3e-04
Breast cancer 1.100 4.8e-04
cystic fibrosis -2.148 7.9e-07
group 4 medulloblastoma -1.100 5.3e-05
intraductal papillary-mucinous adenoma (... -2.900 1.0e-03
intraductal papillary-mucinous carcinoma... -3.700 6.2e-04
lung adenocarcinoma 1.400 1.4e-02
lung cancer -1.800 7.1e-03
lung carcinoma -1.200 3.4e-05
malignant mesothelioma -6.100 4.1e-09
ovarian cancer 3.400 9.2e-05
pancreatic cancer 1.200 3.4e-02
pancreatic carcinoma 1.200 3.4e-02
pituitary cancer -1.600 1.4e-03
primary pancreatic ductal adenocarcinoma 2.489 5.7e-05
tuberculosis 2.400 1.4e-04
ulcerative colitis 1.800 8.5e-05
X-linked cerebral adrenoleukodystrophy 2.100 1.5e-02

 GO Function (1)

Gene RIF (20)

AA Sequence

MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQV      1 - 70
QPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTY     71 - 140
PYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEA    141 - 210
PYKNGRPCSECPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSA    211 - 280
VNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDI    281 - 350
TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE    351 - 420
PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSESLGTPRDGKAF    421 - 490
RIFAVRQ                                                                   491 - 497
//

Text Mined References (30)

PMID Year Title