Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.12
PubTator Score 6.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Brain Injuries 65 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 9.9e-14
diabetes mellitus 1728 2.9e-03
ovarian cancer 8520 3.7e-03
Waldenstrons macroglobulinemia 765 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Tick infestation 17 5.171 2.6

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.100 2.9e-03
non-small cell lung cancer 1.065 9.9e-14
ovarian cancer 1.100 3.7e-03
Waldenstrons macroglobulinemia 1.034 1.5e-02

Gene RIF (1)

AA Sequence

MGRRRAPAGGSLGRALMRHQTQRSRSHRHTDSWLHTSELNDGYDWGRLNLQSVTEQSSLDDFLATAELAG      1 - 70
TEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEELKQAEKDNFLEWR     71 - 140
RQLVRLEEEQKLILTPFERNLDFWRQLWRVIERSDIVVQIVDARNPLLFRCEDLECYVKEMDANKENVIL    141 - 210
INKADLLTAEQRSAWAMYFEKEDVKVIFWSALAGAIPLNGDSEEEANRDDRQSNTTKFGHSSFDQAEISH    211 - 280
SESEHLPARDSPSLSENPTTDEDDSEYEDCPEEEEDDWQTCSEEDGPKEEDCSQDWKESSTADSEARSRK    281 - 350
TPQKRQIHNFSHLVSKQELLELFKELHTGRKVKDGQLTVGLVGYPNVGKSSTINTIMGNKKVSVSATPGH    351 - 420
TKHFQTLYVEPGLCLCDCPGLVMPSFVSTKAEMTCSGILPIDQMRDHVPPVSLVCQNIPRHVLEATYGIN    421 - 490
IITPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILKDYVSGKLLYCHPPPGRDPVTFQH    491 - 560
QHQRLLENKMNSDEIKMQLGRNKKAKQIENIVDKTFFHQENVRALTKGVQAVMGYKPGSGVVTASTASSE    561 - 630
NGAGKPWKKHGNRNKKEKSRRLYKHLDM                                              631 - 658
//

Text Mined References (18)

PMID Year Title