Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.38
PubTator Score 15.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
ependymoma 4679 2.9e-08
ovarian cancer 8520 2.2e-05
glioblastoma 5792 3.5e-05
primitive neuroectodermal tumor 3035 4.7e-04
group 3 medulloblastoma 4104 1.5e-02

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 2.9e-08
glioblastoma 1.100 3.5e-05
group 3 medulloblastoma 1.400 1.5e-02
ovarian cancer -1.700 2.2e-05
primitive neuroectodermal tumor 1.100 4.7e-04

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF      1 - 70
MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA     71 - 140
ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS         141 - 205
//

Text Mined References (23)

PMID Year Title