Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
Funding $1,694,407
PubMed Score 5.38
PubTator Score 15.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 0.000
glioblastoma 1.100 0.000
primitive neuroectodermal tumor 1.100 0.000
group 3 medulloblastoma 1.400 0.015
ovarian cancer -1.700 0.000

Synonym

Accession Q9H081 Q96N24
Symbols MTW1
hMis12
KNTC2AP
2510025F08Rik

Gene

Gene RIF (7)

PMID Text
25601404 Mechanisms of mitosis-specific assembly of the checkpoint platform Knl1/MIS12/NDC80 at human kinetochores.
24530301 RWD-containing proteins interact with the Mis12 complex to shape KMN network topology, as revealed by structural analysis
21875947 HIV-1 Vpr interferes with the heterochromatin structure by displacing HP1-alpha and HP1-gamma proteins in interphase, which leads to relocalization of the centromere chromatin proteins Mis12, Sgo1, and CPC after prophase
21353556 Direct binding of Cenp-C to the Mis12 complex joins the inner and outer kinetochore.
20404110 These findings support a novel role for Hsp90-Sgt1 chaperones in ensuring the fidelity of Mis12 multiprotein complex assembly.
16585270 These results indicate that a four-subunit Mis12 complex plays an essential role in chromosome segregation in vertebrates and contributes to mitotic kinetochore assembly.
12515822 hMIS12 has a role in mitosis and localizes at kinetochores

AA Sequence

MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF      1 - 70
MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA     71 - 140
ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS         141 - 205
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25601404 2015 Multiple assembly mechanisms anchor the KMN spindle checkpoint platform at human mitotic kinetochores.
25416956 2014 A proteome-scale map of the human interactome network.
24530301 2014 Modular assembly of RWD domains on the Mis12 complex underlies outer kinetochore organization.
23891108 2013 Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.
21353556 2011 Direct binding of Cenp-C to the Mis12 complex joins the inner and outer kinetochore.
21269460 2011 Initial characterization of the human central proteome.
20404110 2010 Hsp90-Sgt1 and Skp1 target human Mis12 complexes to ensure efficient formation of kinetochore-microtubule binding sites.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
16585270 2006 The human Mis12 complex is required for kinetochore assembly and proper chromosome segregation.
More...