Property Summary

NCBI Gene PubMed Count 19
Grant Count 15
R01 Count 6
Funding $1,209,610.81
PubMed Score 15.73
PubTator Score 11.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.971 0.030
colon cancer -2.000 0.000
lung cancer -1.900 0.000
interstitial cystitis -2.700 0.000
ovarian cancer 1.200 0.028

Gene RIF (6)

PMID Text
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
21501586 HOXD1 plays a significant role in endothelial cells functions by regulating the expression of ITGB1.
20852632 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852632 Single nucleotide polymorphism in HOXD1 is associated with ovarian cancer.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPA      1 - 70
RPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVF     71 - 140
SGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKV    141 - 210
KRNASKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNR    211 - 280
RMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS                          281 - 328
//

Text Mined References (20)

PMID Year Title
23535375 2013 Interleukin-27 treated human macrophages induce the expression of novel microRNAs which may mediate anti-viral properties.
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
21501586 2011 Homeobox D1 regulates angiogenic functions of endothelial cells via integrin ?1 expression.
20852632 2010 A genome-wide association study identifies susceptibility loci for ovarian cancer at 2q31 and 8q24.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11731253 2001 Cloning of HOXD1 from unfertilised human oocytes and expression analyses during murine oogenesis and embryogenesis.
More...