Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.55
PubTator Score 11.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
colon cancer 1478 8.5e-06
interstitial cystitis 2312 2.5e-04
lung cancer 4740 4.1e-04
ovarian cancer 8520 2.8e-02
osteosarcoma 7950 3.0e-02
Disease Target Count Z-score Confidence
Syndactyly 88 3.14 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -2.000 8.5e-06
interstitial cystitis -2.500 2.5e-04
lung cancer -1.900 4.1e-04
osteosarcoma 1.971 3.0e-02
ovarian cancer 1.200 2.8e-02

Gene RIF (6)

AA Sequence

MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPA      1 - 70
RPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVF     71 - 140
SGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKV    141 - 210
KRNASKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNR    211 - 280
RMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS                          281 - 328
//

Text Mined References (20)

PMID Year Title