Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.76
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4740 4.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -2.000 4.5e-04

Gene RIF (5)

AA Sequence

MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFID      1 - 70
YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLECCLLYLSKTIHPQII          71 - 135
//

Text Mined References (9)

PMID Year Title