Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $325,667.25
PubMed Score 4.76
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung cancer 4,466

Gene RIF (5)

PMID Text
26549570 Study shows that patients with high PBOV1 expression had longer overall survival; patients with low PBOV1 expression had shorter survival suggesting that PBOV1 may play an important role in suppressing ovarian cancer proliferation and carcinogenesis.
23418531 Data indicate that analysis of public microarray data suggests that PBOV1 activation in tumors could be dependent on the Hedgehog signaling pathway.
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17656261 Approximately half of the prostate tumors displayed increased copy numbers of the BMP2, BMP5, BMP7, and UC28 gene loci, which may account for their abnormal gene expression patterns in neoplastic prostate tissue.
12553037 UROC28 mRNA expression was greater in breast cancers than in noncancerous tissues (p < 0.0001), as was ERBB2 mRNA.

AA Sequence

MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFID      1 - 70
YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLECCLLYLSKTIHPQII          71 - 135
//

Text Mined References (9)

PMID Year Title
26549570 2016 PBOV1 correlates with progression of ovarian cancer and inhibits proliferation of ovarian cancer cells.
23418531 2013 PBOV1 is a human de novo gene with tumor-specific expression that is associated with a positive clinical outcome of cancer.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
17656261 2007 Bone morphogenic factor gene dosage abnormalities in prostatic intraepithelial neoplasia and prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12553037 Enhanced expression of the UROC28 gene in human breast cancer: relationship to ERBB2 gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11156405 2000 Cloning and characterization of UROC28, a novel gene overexpressed in prostate, breast, and bladder cancers.