Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 4
Funding $691,804.83
PubMed Score 36.35
PubTator Score 23.23

Knowledge Summary

Patent

No data available

Synonym

Accession Q9GZV8 Q86UX9
Symbols PFM11

Gene

 GO Component (1)

Gene RIF (9)

PMID Text
25750208 In response to cytokines, pluripotent stem cells differentiate first into a heterogeneous mesoderm-like cell population and then into Primordial Germ cell-Like Cells, which exhibit minimal PRDM14 expression.
25233927 The contribution of methylation-mediated gene silencing of PRDM14 to apoptosis evasion in HPV-positive cancer cells offers novel therapeutic options for HPV-induced cancers.
23690269 PRDM14 associated with cell differentiation in NSCLC.
23280602 Study reveals a repressive role of PRDM14 in the maintenance and induction of pluripotency and identifies PRDM14 as a new regulator of PRC2.
20953172 novel hESC regulators wherein PRDM14 exemplifies a key transcription factor required for the maintenance of hESC identity and the reacquisition of pluripotency in human somatic cells
20840815 The high expression of PRDM14 in non-small cell lung cancer is associated with differentiation and histological type.
18194669 These results suggest that PRDM14 is involved in the maintenance of the self-renewal of human ES cells by suppression of gene expression.
18187620 Knockdown of PR domain containing 14 (PRDM14) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17942894 PRDM14 mRNA is overexpressed in about two thirds of breast cancers; moreover, immunohistochemical analysis showed that expression of PRDM14 protein is also up-regulated.

AA Sequence

MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAASAAPAMPPFP      1 - 70
FRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHEYAGASSEDLGHQIIGGDNES     71 - 140
GPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSEDGPKPSNQEGKSPARFQFTEEDLHFVLYGVT    141 - 210
PSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRF    211 - 280
GPFQGKVVNASEVKTYGDNSVMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFY    281 - 350
ESCKEIHQNQELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLK    351 - 420
YTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHMRVHSGDRPYQ    421 - 490
CVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSHKEDDGCSCSICGKIFSDQET    491 - 560
FYSHMKFHEDY                                                               561 - 571
//

Text Mined References (20)

PMID Year Title
27281218 2016 Co-repressor CBFA2T2 regulates pluripotency and germline development.
25750208 2015 Human primordial germ cell commitment in vitro associates with a unique PRDM14 expression profile.
25416956 2014 A proteome-scale map of the human interactome network.
25233927 2014 Methylation-mediated repression of PRDM14 contributes to apoptosis evasion in HPV-positive cancers.
23690269 2013 High expression of PRDM14 correlates with cell differentiation and is a novel prognostic marker in resected non-small cell lung cancer.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23280602 2013 A PRC2-dependent repressive role of PRDM14 in human embryonic stem cells and induced pluripotent stem cell reprogramming.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...