Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.57
PubTator Score 5.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -2.200 0.000
glioblastoma -1.500 0.001
group 3 medulloblastoma -2.200 0.014
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.300 0.001
pediatric high grade glioma -1.800 0.001
subependymal giant cell astrocytoma -1.340 0.044
progressive supranuclear palsy -1.100 0.019
psoriasis -1.800 0.000

Gene RIF (5)

PMID Text
22082156 Knockdown of hyaluronan and proteoglycan link protein 2 (HAPLN2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19633295 Results indicate that HAPLN4 and HAPLN2 are the predominant members of this family in the adult human brain but are strongly reduced in the tumor parenchyma.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
11873941 gene locus at chromosome 1q21-23.

AA Sequence

MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRW      1 - 70
SKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVA     71 - 140
LTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLT    141 - 210
ARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYA    211 - 280
AWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN              281 - 340
//

Text Mined References (10)

PMID Year Title
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
19633295 2009 Reduced expression of the hyaluronan and proteoglycan link proteins in malignant gliomas.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12663660 2003 A hyaluronan binding link protein gene family whose members are physically linked adjacent to chondroitin sulfate proteoglycan core protein genes: the missing links.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11873941 2002 Human BRAL1 and BCAN genes that belong to the link-module superfamily are tandemly arranged on chromosome 1q21-23.
11817897 2002 Bral1, a brain-specific link protein, colocalizing with the versican V2 isoform at the nodes of Ranvier in developing and adult mouse central nervous systems.
11027579 2000 The brain link protein-1 (BRAL1): cDNA cloning, genomic structure, and characterization as a novel link protein expressed in adult brain.