Property Summary

NCBI Gene PubMed Count 121
PubMed Score 114.41
PubTator Score 49.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Muscular atrophy 67
Disease Target Count P-value
glioblastoma multiforme 347 3.89537962501588E-27
lung carcinoma 2844 1.27767904703012E-19
posterior fossa group A ependymoma 1511 1.21801900224886E-13
astrocytoma 1493 3.7688582278244E-11
juvenile dermatomyositis 1189 1.19664899939458E-10
psoriasis 6685 2.74942768160292E-9
Duchenne muscular dystrophy 602 3.3665334438511E-9
pilocytic astrocytoma 3086 1.57883648882281E-8
Breast cancer 3099 1.14872952815121E-6
atypical teratoid / rhabdoid tumor 4369 2.49176065792196E-6
pituitary cancer 1972 3.0382720477267E-5
ovarian cancer 8492 5.51776523945247E-5
Amyotrophic Lateral Sclerosis 432 1.00029482734403E-4
gastric cancer 436 1.64071861703306E-4
osteosarcoma 7933 1.76196231012097E-4
acute quadriplegic myopathy 1157 4.13331275181989E-4
ulcerative colitis 2087 4.84527684352917E-4
limb girdle muscular dystrophy 2A 156 7.30589607997447E-4
pediatric high grade glioma 2712 0.00160498402352449
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00233034714835278
subependymal giant cell astrocytoma 2287 0.00355770299899716
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00468186168446563
dermatomyositis 967 0.00546075206375591
invasive ductal carcinoma 2950 0.00573238191053284
Down syndrome 548 0.00624962560417797
Pick disease 1893 0.00670826714608092
group 4 medulloblastoma 1875 0.00845940209376296
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00868527154663315
colon cancer 1475 0.015298136934226
diabetes mellitus 1663 0.0228636115584924
Becker muscular dystrophy 187 0.0278820728356397
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0334016517077492
spina bifida 1064 0.0373708376733857
active Crohn's disease 918 0.039001663610856
medulloblastoma, large-cell 6234 0.0495414809095708
Disease Target Count Z-score Confidence
Cancer 2346 3.665 1.8
Disease Target Count Z-score Confidence
Histiocytoid hemangioma 3 4.298 2.1
Fibrochondrogenesis 8 3.022 1.5
Disease Target Count
Epithelioid hemangioendothelioma 5

Expression

Synonym

Accession Q9GZV5 D3DNH7 Q8N3P2 Q9Y3W6
Symbols TAZ

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (107)

PMID Text
26838548 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26678338 MYC-driven change in mitochondrial dynamics limits YAP/TAZ function in mammary epithelial cells and breast neoplasms.
26668268 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation
26667495 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions
26611634 The TAZ play an essential role in amino acid-induced mTORC1 activation, particularly under nutrient-limiting conditions.
26567630 TAZ may be involved in pancreatic tissue regeneration, and that deregulation of these proteins may play a role in neoplastic transformation and stellate cell functions in both PDAC and pancreatitis.
26491017 activation of the Nherf1-PP1alpha-TAZ pathway in osteoblasts is targeted by histone deacetylase inhibitors
26464030 Suggest that high expression of TAZ plays a significant role in retinoblastoma's aggressiveness, and predicts poor prognosis for patients with retinoblastoma.
26439301 YAP/TAZ regulate transcriptional elongation from the enhancer elements by recruiting the Mediator complex and promoting phenotypes of overgrowth and tumorigenesis.
26432639 This study identifies a novel mechanism of TAZ regulation by YAP, which has significant implications for our understanding of Hippo pathway regulation, YAP-isoform specific signaling, and the role of these proteins in cell proliferation, apoptosis, and tumorigenesis
More...

AA Sequence

MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS      1 - 70
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR     71 - 140
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP    141 - 210
TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN    211 - 280
PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI    281 - 350
NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL                        351 - 400
//

Text Mined References (128)

PMID Year Title
26838548 2016 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26678338 2015 A MYC-Driven Change in Mitochondrial Dynamics Limits YAP/TAZ Function in Mammary Epithelial Cells and Breast Cancer.
26668268 2016 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation.
26667495 2015 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions.
26611634 2015 The Hippo pathway effectors YAP and TAZ promote cell growth by modulating amino acid signaling to mTORC1.
26567630 2015 Role of YAP and TAZ in pancreatic ductal adenocarcinoma and in stellate cells associated with cancer and chronic pancreatitis.
26491017 2015 Histone Deacetylase Inhibitors Target the Leukemic Microenvironment by Enhancing a Nherf1-Protein Phosphatase 1?-TAZ Signaling Pathway in Osteoblasts.
26464030 2015 High expression of TAZ indicates a poor prognosis in retinoblastoma.
26439301 2015 YAP Drives Growth by Controlling Transcriptional Pause Release from Dynamic Enhancers.
26432639 2015 TAZ Protein Accumulation Is Negatively Regulated by YAP Abundance in Mammalian Cells.
More...