Property Summary

NCBI Gene PubMed Count 159
PubMed Score 146.76
PubTator Score 49.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Muscular atrophy 71 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 3.829 1.9
Disease Target Count Z-score Confidence
Histiocytoid hemangioma 3 4.099 2.0
Disease Target Count
Epithelioid hemangioendothelioma 5

Expression

  Differential Expression (35)

Disease log2 FC p
active Crohn's disease 2.326 3.9e-02
acute quadriplegic myopathy 1.360 4.1e-04
adult high grade glioma 1.200 1.0e-02
Amyotrophic lateral sclerosis 1.125 1.0e-04
astrocytoma 1.100 1.7e-10
Astrocytoma, Pilocytic 1.800 9.2e-06
atypical teratoid / rhabdoid tumor 2.300 2.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.488 8.7e-03
Becker muscular dystrophy 1.167 2.8e-02
Breast cancer -1.500 1.1e-06
colon cancer -1.700 3.2e-03
dermatomyositis 1.300 5.5e-03
diabetes mellitus -1.100 2.3e-02
Down syndrome 1.300 6.2e-03
Duchenne muscular dystrophy 2.114 3.4e-09
ependymoma 2.000 1.0e-09
gastric cancer 1.300 1.6e-04
glioblastoma 1.100 1.2e-02
group 4 medulloblastoma -1.400 8.5e-03
intraductal papillary-mucinous adenoma (... -1.500 1.7e-03
intraductal papillary-mucinous carcinoma... -2.200 8.5e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.3e-02
invasive ductal carcinoma -1.700 5.7e-03
juvenile dermatomyositis 1.772 1.2e-10
limb girdle muscular dystrophy 2A 1.015 7.3e-04
lung carcinoma -1.700 1.3e-19
medulloblastoma, large-cell -1.100 5.0e-02
osteosarcoma 2.347 1.8e-04
ovarian cancer -1.600 5.4e-05
Pick disease 1.700 6.7e-03
pituitary cancer -2.100 3.0e-05
psoriasis 1.900 2.7e-09
spina bifida -1.921 3.7e-02
subependymal giant cell astrocytoma 2.664 1.0e-02
ulcerative colitis 1.500 4.8e-04

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (145)

AA Sequence

MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS      1 - 70
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR     71 - 140
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP    141 - 210
TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN    211 - 280
PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI    281 - 350
NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL                        351 - 400
//

Text Mined References (166)

PMID Year Title