Property Summary

NCBI Gene PubMed Count 121
PubMed Score 114.41
PubTator Score 49.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9GZV5 D3DNH7 Q8N3P2 Q9Y3W6
Symbols TAZ

Gene

 GWAS Trait (1)

Gene RIF (107)

PMID Text
26838548 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26678338 MYC-driven change in mitochondrial dynamics limits YAP/TAZ function in mammary epithelial cells and breast neoplasms.
26668268 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation
26667495 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions
26611634 The TAZ play an essential role in amino acid-induced mTORC1 activation, particularly under nutrient-limiting conditions.
26567630 TAZ may be involved in pancreatic tissue regeneration, and that deregulation of these proteins may play a role in neoplastic transformation and stellate cell functions in both PDAC and pancreatitis.
26491017 activation of the Nherf1-PP1alpha-TAZ pathway in osteoblasts is targeted by histone deacetylase inhibitors
26464030 Suggest that high expression of TAZ plays a significant role in retinoblastoma's aggressiveness, and predicts poor prognosis for patients with retinoblastoma.
26439301 YAP/TAZ regulate transcriptional elongation from the enhancer elements by recruiting the Mediator complex and promoting phenotypes of overgrowth and tumorigenesis.
26432639 This study identifies a novel mechanism of TAZ regulation by YAP, which has significant implications for our understanding of Hippo pathway regulation, YAP-isoform specific signaling, and the role of these proteins in cell proliferation, apoptosis, and tumorigenesis
More...

AA Sequence

MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS      1 - 70
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR     71 - 140
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP    141 - 210
TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN    211 - 280
PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI    281 - 350
NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL                        351 - 400
//

Text Mined References (128)

PMID Year Title
26838548 2016 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26678338 2015 A MYC-Driven Change in Mitochondrial Dynamics Limits YAP/TAZ Function in Mammary Epithelial Cells and Breast Cancer.
26668268 2016 Actin remodeling confers BRAF inhibitor resistance to melanoma cells through YAP/TAZ activation.
26667495 2015 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions.
26611634 2015 The Hippo pathway effectors YAP and TAZ promote cell growth by modulating amino acid signaling to mTORC1.
26567630 2015 Role of YAP and TAZ in pancreatic ductal adenocarcinoma and in stellate cells associated with cancer and chronic pancreatitis.
26491017 2015 Histone Deacetylase Inhibitors Target the Leukemic Microenvironment by Enhancing a Nherf1-Protein Phosphatase 1?-TAZ Signaling Pathway in Osteoblasts.
26464030 2015 High expression of TAZ indicates a poor prognosis in retinoblastoma.
26439301 2015 YAP Drives Growth by Controlling Transcriptional Pause Release from Dynamic Enhancers.
26432639 2015 TAZ Protein Accumulation Is Negatively Regulated by YAP Abundance in Mammalian Cells.
More...