Property Summary

NCBI Gene PubMed Count 31
PubMed Score 42.03
PubTator Score 49.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (23)

PMID Text
26465952 Data indicate that regulation of sonic hedgehog (SHh)-GLI family zinc finger 1 (Gli1) signals to migration of pancreatic cancer AsPC-1 Cells through mediating eukaryotic translation initiation factor 5A (EIF5A2) gene expression.
26317793 Data suggest that eukaryotic translation initiation factor 5A2 (EIF5A2) inhibitors might be considered as combination therapy to enhance chemosensitivity in patients with esophageal squamous cell carcinoma (ESCC).
26309359 MiR-30b suppresses tumor migration and invasion by targeting EIF5A2 expression in gastric cancer cells.
25793713 Our findings indicate that EIF5A2 upregulation plays an important oncogenic role in gastric cancer. EIF5A2 may represent a new predictor for poor survival and is a potential therapeutic target for gastric cancer.
24638963 eIF-5A2 plays an important role in doxorubicin chemoresistance in breast cancer cells.
24561231 Increased expression of eIF5A2 increases metastasis and angiogenesis in esophageal squamous cell carcinoma via the HIF1alpha-mediated signaling pathway.
24504366 EIF5A2 elevated TGF-beta1 expression through STAT3 to induce epithelial-mesenchymal transition and promotes aggressiveness in bladder cancer.
24262005 It significantly inhibited activity of eIF5A2.
24250246 focus on updating current knowledge of the EIF5A2 gene in human cancers
24178756 None of the latter died within 5 years in EIF5A2-negative staining group.
More...

AA Sequence

MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCA     71 - 140
MSEEYAVAIKPCK                                                             141 - 153
//

Text Mined References (33)

PMID Year Title
26465952 2015 Sonic Hedgehog-GLI Family Zinc Finger 1 Signaling Pathway Promotes the Growth and Migration of Pancreatic Cancer Cells by Regulating the Transcription of Eukaryotic Translation Initiation Factor 5A2.
26317793 2015 Stemness and chemotherapeutic drug resistance induced by EIF5A2 overexpression in esophageal squamous cell carcinoma.
26309359 2015 MiR-30b suppresses tumor migration and invasion by targeting EIF5A2 in gastric cancer.
25793713 2015 Overexpression of eukaryotic translation initiation factor 5A2 (EIF5A2) correlates with cell aggressiveness and poor survival in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24638963 2015 EIF5A2 is a novel chemoresistance gene in breast cancer.
24561231 2014 Increased expression of EIF5A2, via hypoxia or gene amplification, contributes to metastasis and angiogenesis of esophageal squamous cell carcinoma.
24504366 2014 EIF5A2 predicts outcome in localised invasive bladder cancer and promotes bladder cancer cell aggressiveness in vitro and in vivo.
24262005 2014 N1-guanyl-1,7-diaminoheptane sensitizes bladder cancer cells to doxorubicin by preventing epithelial-mesenchymal transition through inhibition of eukaryotic translation initiation factor 5A2 activation.
24250246 2013 Roles of eukaryotic initiation factor 5A2 in human cancer.
More...