Property Summary

NCBI Gene PubMed Count 35
PubMed Score 46.53
PubTator Score 49.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis 1.522 3.5e-03
adult high grade glioma -1.100 5.7e-03
astrocytic glioma -1.200 3.2e-02
Astrocytoma, Pilocytic -1.400 3.5e-04
atypical teratoid / rhabdoid tumor -1.300 1.1e-03
cystic fibrosis 1.313 3.0e-05
ependymoma -2.300 3.1e-02
glioblastoma -1.400 1.3e-03
group 3 medulloblastoma -2.300 4.5e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.0e-02
malignant mesothelioma -1.600 4.8e-07
medulloblastoma, large-cell -2.400 1.4e-03
nasopharyngeal carcinoma 1.400 2.3e-03
non-small cell lung cancer 1.265 3.3e-09
oligodendroglioma -2.300 2.1e-02
ovarian cancer -1.500 7.4e-05
Pick disease -1.100 3.8e-02
primitive neuroectodermal tumor -1.300 2.5e-02
tuberculosis -1.100 7.4e-06

Gene RIF (27)

AA Sequence

MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCA     71 - 140
MSEEYAVAIKPCK                                                             141 - 153
//

Text Mined References (37)

PMID Year Title