Property Summary

NCBI Gene PubMed Count 29
PubMed Score 132.77
PubTator Score 102.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -2.000 7.7e-04
astrocytic glioma -1.600 2.6e-02
Breast cancer -2.900 1.4e-04
breast carcinoma -1.900 3.7e-25
chronic rhinosinusitis -1.134 3.5e-02
colon cancer -2.700 4.1e-04
cutaneous lupus erythematosus -1.900 1.9e-04
ductal carcinoma in situ -1.700 5.9e-04
ependymoma -2.200 1.4e-02
facioscapulohumeral dystrophy 2.500 8.4e-04
glioblastoma -1.700 3.8e-03
group 4 medulloblastoma -1.500 9.0e-06
interstitial cystitis -1.800 1.2e-03
intraductal papillary-mucinous adenoma (... -3.500 2.6e-05
intraductal papillary-mucinous carcinoma... -3.800 2.4e-05
intraductal papillary-mucinous neoplasm ... -3.900 5.8e-04
invasive ductal carcinoma -1.903 2.3e-04
lung cancer -2.300 9.5e-04
medulloblastoma, large-cell -1.600 1.5e-04
non-small cell lung cancer -1.153 5.3e-12
oligodendroglioma -1.900 3.7e-09
ovarian cancer -4.800 1.3e-07
psoriasis -1.800 3.0e-10
subependymal giant cell astrocytoma -2.943 4.6e-02

Gene RIF (21)

AA Sequence

MLPPKHLSATKPKKSWAPNLYELDSDLTKEPDVIIGEGPTDSEFFHQRFRNLIYVEFVGPRKTLIKLRNL      1 - 70
CLDWLQPETRTKEEIIELLVLEQYLTIIPEKLKPWVRAKKPENCEKLVTLLENYKEMYQPEDDNNSDVTS     71 - 140
DDDMTRNRRESSPPHSVHSFSDRDWDRRGRSRDMEPRDRWSHTRNPRSRMPPRDLSLPVVAKTSFEMDRE    141 - 210
DDRDSRAYESRSQDAESYQNVVDLAEDRKPHNTIQDNMENYRKLLSLVQLAEDDGHSHMTQGHSSRSKRS    211 - 280
AYPSTSRGLKTMPEAKKSTHRRGICEDESSHGVIMEKFIKDVSRSSKSGRARESSDRSQRFPRMSDDNWK    281 - 350
DISLNKRESVIQQRVYEGNAFRGGFRFNSTLVSRKRVLERKRRYHFDTDGKGSIHDQKGCPRKKPFECGS    351 - 420
EMRKAMSVSSLSSLSSPSFTESQPIDFGAMPYVCDECGRSFSVISEFVEHQIMHTRENLYEYGESFIHSV    421 - 490
AVSEVQKSQVGGKRFECKDCGETFNKSAALAEHRKIHARGYLVECKNQECEEAFMPSPTFSELQKIYGKD    491 - 560
KFYECRVCKETFLHSSALIEHQKIHFGDDKDNEREHERERERERGETFRPSPALNEFQKMYGKEKMYECK    561 - 630
VCGETFLHSSSLKEHQKIHTRGNPFENKGKVCEETFIPGQSLKRRQKTYNKEKLCDFTDGRDAFMQSSEL    631 - 700
SEHQKIHSRKNLFEGRGYEKSVIHSGPFTESQKSHTITRPLESDEDEKAFTISSNPYENQKIPTKENVYE    701 - 770
AKSYERSVIHSLASVEAQKSHSVAGPSKPKVMAESTIQSFDAINHQRVRAGGNTSEGREYSRSVIHSLVA    771 - 840
SKPPRSHNGNELVESNEKGESSIYISDLNDKRQKIPARENPCEGGSKNRNYEDSVIQSVFRAKPQKSVPG    841 - 910
EGSGEFKKDGEFSVPSSNVREYQKARAKKKYIEHRSNETSVIHSLPFGEQTFRPRGMLYECQECGECFAH    911 - 980
SSDLTEHQKIHDREKPSGSRNYEWSVIRSLAPTDPQTSYAQEQYAKEQARNKCKDFRQFFATSEDLNTNQ    981 - 1050
KIYDQEKSHGEESQGENTDGEETHSEETHGQETIEDPVIQGSDMEDPQKDDPDDKIYECEDCGLGFVDLT   1051 - 1120
DLTDHQKVHSRKCLVDSREYTHSVIHTHSISEYQRDYTGEQLYECPKCGESFIHSSFLFEHQRIHEQDQL   1121 - 1190
YSMKGCDDGFIALLPMKPRRNRAAERNPALAGSAIRCLLCGQGFIHSSALNEHMRLHREDDLLEQSQMAE   1191 - 1260
EAIIPGLALTEFQRSQTEERLFECAVCGESFVNPAELADHVTVHKNEPYEYGSSYTHTSFLTEPLKGAIP   1261 - 1330
FYECKDCGKSFIHSTVLTKHKELHLEEEEEDEAAAAAAAAAQEVEANVHVPQVVLRIQGLNVEAAEPEVE   1331 - 1400
AAEPEVEAAEPEVEAAEPNGEAEGPDGEAAEPIGEAGQPNGEAEQPNGDADEPDGAGIEDPEERAEEPEG   1401 - 1470
KAEEPEGDADEPDGVGIEDPEEGEDQEIQVEEPYYDCHECTETFTSSTAFSEHLKTHASMIIFEPANAFG   1471 - 1540
ECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG                         1541 - 1588
//

Text Mined References (34)

PMID Year Title