Property Summary

NCBI Gene PubMed Count 25
Grant Count 58
R01 Count 30
Funding $4,440,488.67
PubMed Score 120.76
PubTator Score 102.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession Q9GZU2 A7E2B8 B4DIM4 C9JP50 P78418 Q5H9P9 Q7Z7H7 Q8TF75 Q9GZY2
Symbols PW1
ZNF904
ZSCAN24
ZKSCAN22

Gene

PDB

4BHX  

Gene RIF (17)

PMID Text
26838788 A resident population of resident smooth muscle progenitor cells expressing PW1 was identified in pulmonary hypertension-associated vascular remodeling.
25751651 PW1/Peg3 function is essential for conferring proper mesoangioblast competence and it's level in human mesoangioblasts may serve as a biomarker to identify donor populations for therapeutic application in muscular dystrophies.
24120702 Genetic translocations involving PEG3 gene is associated with mesenchymal hamartoma of the liver.
23936039 The PEG3-SCAN domain appears to constitute an assembly block, enabling PEG3 homo- or heterodimerization to control gene expression in a combinatorial fashion.
23798385 we have unveiled a mechanism for a secreted proteoglycan in inducing Peg3, a master regulator of macroautophagy in endothelial cells
23418553 Results show that a five percent increase in DNA methylation of PEG3 is associated with a 1.6-fold increase invasive cervical cancer (ICC) risk.
23151531 None of the folate cycle genotypes in the mother or infant were related to the methylation of IGF2, PEG3, or LINE-1.
20064927 mammalian imprinting utilizes Peg3/Pw1 to co-opt the Wnt pathway, thereby regulating development and glioma growth
19834535 Observational study of gene-disease association. (HuGE Navigator)
19397955 PEG3 imprinted domain of humans, cows, and mice contains differing numbers of differentially methylated regions (DMR), but the PEG3-CpG island is the only DMR that is conserved among these three species.
More...

AA Sequence

MLPPKHLSATKPKKSWAPNLYELDSDLTKEPDVIIGEGPTDSEFFHQRFRNLIYVEFVGPRKTLIKLRNL      1 - 70
CLDWLQPETRTKEEIIELLVLEQYLTIIPEKLKPWVRAKKPENCEKLVTLLENYKEMYQPEDDNNSDVTS     71 - 140
DDDMTRNRRESSPPHSVHSFSDRDWDRRGRSRDMEPRDRWSHTRNPRSRMPPRDLSLPVVAKTSFEMDRE    141 - 210
DDRDSRAYESRSQDAESYQNVVDLAEDRKPHNTIQDNMENYRKLLSLVQLAEDDGHSHMTQGHSSRSKRS    211 - 280
AYPSTSRGLKTMPEAKKSTHRRGICEDESSHGVIMEKFIKDVSRSSKSGRARESSDRSQRFPRMSDDNWK    281 - 350
DISLNKRESVIQQRVYEGNAFRGGFRFNSTLVSRKRVLERKRRYHFDTDGKGSIHDQKGCPRKKPFECGS    351 - 420
EMRKAMSVSSLSSLSSPSFTESQPIDFGAMPYVCDECGRSFSVISEFVEHQIMHTRENLYEYGESFIHSV    421 - 490
AVSEVQKSQVGGKRFECKDCGETFNKSAALAEHRKIHARGYLVECKNQECEEAFMPSPTFSELQKIYGKD    491 - 560
KFYECRVCKETFLHSSALIEHQKIHFGDDKDNEREHERERERERGETFRPSPALNEFQKMYGKEKMYECK    561 - 630
VCGETFLHSSSLKEHQKIHTRGNPFENKGKVCEETFIPGQSLKRRQKTYNKEKLCDFTDGRDAFMQSSEL    631 - 700
SEHQKIHSRKNLFEGRGYEKSVIHSGPFTESQKSHTITRPLESDEDEKAFTISSNPYENQKIPTKENVYE    701 - 770
AKSYERSVIHSLASVEAQKSHSVAGPSKPKVMAESTIQSFDAINHQRVRAGGNTSEGREYSRSVIHSLVA    771 - 840
SKPPRSHNGNELVESNEKGESSIYISDLNDKRQKIPARENPCEGGSKNRNYEDSVIQSVFRAKPQKSVPG    841 - 910
EGSGEFKKDGEFSVPSSNVREYQKARAKKKYIEHRSNETSVIHSLPFGEQTFRPRGMLYECQECGECFAH    911 - 980
SSDLTEHQKIHDREKPSGSRNYEWSVIRSLAPTDPQTSYAQEQYAKEQARNKCKDFRQFFATSEDLNTNQ    981 - 1050
KIYDQEKSHGEESQGENTDGEETHSEETHGQETIEDPVIQGSDMEDPQKDDPDDKIYECEDCGLGFVDLT   1051 - 1120
DLTDHQKVHSRKCLVDSREYTHSVIHTHSISEYQRDYTGEQLYECPKCGESFIHSSFLFEHQRIHEQDQL   1121 - 1190
YSMKGCDDGFIALLPMKPRRNRAAERNPALAGSAIRCLLCGQGFIHSSALNEHMRLHREDDLLEQSQMAE   1191 - 1260
EAIIPGLALTEFQRSQTEERLFECAVCGESFVNPAELADHVTVHKNEPYEYGSSYTHTSFLTEPLKGAIP   1261 - 1330
FYECKDCGKSFIHSTVLTKHKELHLEEEEEDEAAAAAAAAAQEVEANVHVPQVVLRIQGLNVEAAEPEVE   1331 - 1400
AAEPEVEAAEPEVEAAEPNGEAEGPDGEAAEPIGEAGQPNGEAEQPNGDADEPDGAGIEDPEERAEEPEG   1401 - 1470
KAEEPEGDADEPDGVGIEDPEEGEDQEIQVEEPYYDCHECTETFTSSTAFSEHLKTHASMIIFEPANAFG   1471 - 1540
ECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG                         1541 - 1588
//

Text Mined References (30)

PMID Year Title
26838788 2016 Resident PW1+ Progenitor Cells Participate in Vascular Remodeling During Pulmonary Arterial Hypertension.
25751651 2015 PW1/Peg3 expression regulates key properties that determine mesoangioblast stem cell competence.
24120702 2013 Characterization of translocations in mesenchymal hamartoma and undifferentiated embryonal sarcoma of the liver.
23936039 2013 Structure of the SCAN domain of human paternally expressed gene 3 protein.
23798385 2013 Decorin causes autophagy in endothelial cells via Peg3.
23418553 2013 Associations between methylation of paternally expressed gene 3 (PEG3), cervical intraepithelial neoplasia and invasive cervical cancer.
23151531 2013 Folate in pregnancy and imprinted gene and repeat element methylation in the offspring.
21269460 2011 Initial characterization of the human central proteome.
20064927 2010 The imprinted gene PEG3 inhibits Wnt signaling and regulates glioma growth.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
More...