Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.18
PubTator Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.77459871707304E-13
psoriasis 6685 6.67459957716979E-8
medulloblastoma, large-cell 6234 1.04584416869461E-5
Multiple myeloma 1328 5.84297248786409E-5
ovarian cancer 8492 2.10266905354535E-4
inflammatory breast cancer 404 0.00124377198032776
diabetes mellitus 1663 0.00175064247279465
group 3 medulloblastoma 2254 0.00758973583837434
subependymal giant cell astrocytoma 2287 0.0100217860339023
interstitial lung disease 292 0.0112675083483193
Waldenstrons macroglobulinemia 765 0.0112744568162301
glioblastoma 5572 0.0233227993052002
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0316506310787195

Expression

  Differential Expression (13)

Synonym

Accession Q9GZU0 Q3LIB6 Q5JVZ2 Q5JVZ3 Q6IA63 Q9H1Z2
Symbols XTP12
dJ30M3.2
Nbla00237

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

AA Sequence

MGDPNSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKG      1 - 70
VRDSSYSLESSLELLQKDVVQLHAPRYQSMRRDVIGCTQEMDFILWPRNDIEKIVCLLFSRWKESDEPFR     71 - 140
PVQAKFEFHHGDYEKQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQ    141 - 210
LTHWAVGTIEDHLRPYMPE                                                       211 - 229
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.