Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $285,094.67
PubMed Score 5.13
PubTator Score 3.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.046 0.001
intraductal papillary-mucinous neoplasm ... 1.200 0.009
lung cancer 1.200 0.000
acute myeloid leukemia -1.300 0.047
ovarian cancer 1.600 0.002
pituitary cancer 1.100 0.000
dermatomyositis 1.200 0.001

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT      1 - 70
NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW     71 - 140
LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN    141 - 210
LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL    211 - 280
ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL    281 - 350
RDMLDSHLENKINIILSETDRDPLQVV                                               351 - 377
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19060904 2009 An empirical framework for binary interactome mapping.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...