Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.13
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pituitary cancer 1972 8.36228176025598E-11
lung cancer 4473 2.69259368876296E-4
osteosarcoma 7933 5.29338137616646E-4
dermatomyositis 967 7.61825611944526E-4
ovarian cancer 8492 0.00182547211269167
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00895364813395885
acute myeloid leukemia 785 0.0473139270975213
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.893 1.9

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.046 0.001
intraductal papillary-mucinous neoplasm ... 1.200 0.009
lung cancer 1.200 0.000
acute myeloid leukemia -1.300 0.047
ovarian cancer 1.600 0.002
pituitary cancer 1.100 0.000
dermatomyositis 1.200 0.001

Synonym

Accession Q9GZT8 Q53TX4 Q6X735 Q9H2D2 Q9HC18
Symbols CALS-7
MDS015
ALS2CR1

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
Fruitfly OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT      1 - 70
NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW     71 - 140
LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN    141 - 210
LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL    211 - 280
ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL    281 - 350
RDMLDSHLENKINIILSETDRDPLQVV                                               351 - 377
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19060904 2009 An empirical framework for binary interactome mapping.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...