Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.30
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.922 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.300 4.7e-02
dermatomyositis 1.200 7.6e-04
intraductal papillary-mucinous neoplasm ... 1.200 9.0e-03
lung cancer 1.200 2.7e-04
osteosarcoma -1.046 5.3e-04
ovarian cancer 1.600 1.8e-03
pituitary cancer 1.100 8.4e-11

Gene RIF (1)

AA Sequence

MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT      1 - 70
NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW     71 - 140
LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN    141 - 210
LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL    211 - 280
ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL    281 - 350
RDMLDSHLENKINIILSETDRDPLQVV                                               351 - 377
//

Text Mined References (24)

PMID Year Title