Property Summary

NCBI Gene PubMed Count 41
Grant Count 28
R01 Count 5
Funding $2,438,356.68
PubMed Score 380.48
PubTator Score 85.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26049155 WNT10A exonic variant increases the risk of keratoconus by decreasing corneal thickness
25795715 High WNT10A expression promotes an invasive and self-renewing phenotype in esophageal squamous cell carcinoma
25612571 this study demonstrated that common variations in WNT10A have pleiotropic effects on the morphology of ectodermal appendages.
25545742 p.Arg113Cys, p.Phe228Ile, newly identified p.Arg171Leu may represent aetiological mutations underlying MLIA w/associated dental anomalies, implicating coding variants in WNT10A gene
25134734 WNT10A promotes the proliferation of DPCs and negatively regulates their odontoblastic differentiation.
25054240 WNT10A may induce kidney fibrosis and associate with kidney dysfunction in acute interstitial nephritis.
24957471 transmission disequilibrium test showed transmitted disequilibrium in C392T. we found an association between the C392T variant and nonsyndromic oral clefts.
24798981 The novel c.-14_7delinsC mutation might be the etiological variant of the WNT10A gene responsible for the permanent tooth agenesis in the Egyptian family.
24700731 Patients with bi-allelic WNT10A mutations have severe tooth agenesis.
24554542 involvement of PAX9, EDA, SPRY2, SPRY4, and WNT10A as risk factors for MLIA. uncovered 3 strong synergistic interactions between MLIA liability and MSX1-TGFA, AXIN2-TGFA, and SPRY2-SPRY4 gene pairs. 1st evidence of sprouty genes in MLIA susceptibility.
More...

AA Sequence

MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTVCLTLPGLSRR      1 - 70
QMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSRGFRESAFAYAIAAAG     71 - 140
VVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWE    141 - 210
WGGCSPDMGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVT    211 - 280
PEFRTVGALLRSRFHRATLIRPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREP    281 - 350
RLDSAGTVGRLCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK       351 - 417
//

Text Mined References (43)

PMID Year Title
26049155 2015 WNT10A exonic variant increases the risk of keratoconus by decreasing corneal thickness.
25795715 2015 WNT10A promotes an invasive and self-renewing phenotype in esophageal squamous cell carcinoma.
25612571 2015 Common polymorphisms in WNT10A affect tooth morphology as well as hair shape.
25545742 2015 WNT10A coding variants and maxillary lateral incisor agenesis with associated dental anomalies.
25134734 2014 Effects of WNT10A on proliferation and differentiation of human dental pulp cells.
25054240 2014 Role of WNT10A-expressing kidney fibroblasts in acute interstitial nephritis.
24957471 2014 C392T polymorphism of the Wnt10a gene in non-syndromic oral cleft in a northeastern Chinese population.
24798981 2014 A novel WNT10A mutation causes non-syndromic hypodontia in an Egyptian family.
24700731 2014 The WNT10A gene in ectodermal dysplasias and selective tooth agenesis.
24554542 2014 Identification of genetic risk factors for maxillary lateral incisor agenesis.
More...