Property Summary

NCBI Gene PubMed Count 48
PubMed Score 436.32
PubTator Score 85.64

Knowledge Summary

Patent

No data available

Expression

 IMPC Phenotype (1)

Gene RIF (39)

AA Sequence

MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTVCLTLPGLSRR      1 - 70
QMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSRGFRESAFAYAIAAAG     71 - 140
VVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWE    141 - 210
WGGCSPDMGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVT    211 - 280
PEFRTVGALLRSRFHRATLIRPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREP    281 - 350
RLDSAGTVGRLCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK       351 - 417
//

Text Mined References (50)

PMID Year Title