Property Summary

NCBI Gene PubMed Count 26
PubMed Score 3.36
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 4.22909018659153E-7
atypical teratoid/rhabdoid tumor 1095 1.6141258568569E-6
glioblastoma 5572 4.29033791043281E-6
malignant mesothelioma 3163 6.13484621794616E-5
ovarian cancer 8492 2.69031826011765E-4
osteosarcoma 7933 2.8832451044345E-4
adult high grade glioma 2148 3.60467327104353E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0429569153469634

Expression

  Differential Expression (8)

Synonym

Accession Q9GZR7 E7EMJ4 Q4V9L5
Symbols

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
25867071 DDX24 is a negative regulator of p53 transcriptional activity.DDX24 inhibits p300 mediated acetylation of p53.
24980433 depletion of DDX24 in cells impaired pre-rRNA processing and resulted both in abrogation of MDM2 function and in consequent p53 stabilization
22174317 HIV-1 Rev interacting protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 (DDX24), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20237496 Observational study of gene-disease association. (HuGE Navigator)
18289627 knockdown of a DEAD-box protein named DDX24 inhibits the packaging of HIV-1 RNA and thus diminishes viral infectivity.
18289627 HIV-1 Rev interacting protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 (DDX24), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MKLKDTKSRPKQSSCGKFQTKGIKVVGKWKEVKIDPNMFADGQMDDLVCFEELTDYQLVSPAKNPSSLFS      1 - 70
KEAPKRKAQAVSEEEEEEEGKSSSPKKKIKLKKSKNVATEGTSTQKEFEVKDPELEAQGDDMVCDDPEAG     71 - 140
EMTSENLVQTAPKKKKNKGKKGLEPSQSTAAKVPKKAKTWIPEVHDQKADVSAWKDLFVPRPVLRALSFL    141 - 210
GFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHAVLQWQKRNAAPPPSNTEAPPGETRTE    211 - 280
AGAETRSPGKAEAESDALPDDTVIESEALPSDIAAEARAKTGGTVSDQALLFGDDDAGEGPSSLIREKPV    281 - 350
PKQNENEEENLDKEQTGNLKQELDDKSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAI    351 - 420
LVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE    421 - 490
MLNDSQYNPKRQTLVFSATLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATV    491 - 560
ETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNL    561 - 630
EQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFK    631 - 700
KIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKG    701 - 770
GKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK    771 - 840
TKKPKEPQPEQPQPSTSAN                                                       841 - 859
//

Text Mined References (37)

PMID Year Title
25867071 2016 Negative regulation of the p300-p53 interplay by DDX24.
24980433 2014 MDM2 mediates nonproteolytic polyubiquitylation of the DEAD-Box RNA helicase DDX24.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
More...