Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
R01 Count 4
Funding $138,681.25
PubMed Score 3.36
PubTator Score 2.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (6)

PMID Text
25867071 DDX24 is a negative regulator of p53 transcriptional activity.DDX24 inhibits p300 mediated acetylation of p53.
24980433 depletion of DDX24 in cells impaired pre-rRNA processing and resulted both in abrogation of MDM2 function and in consequent p53 stabilization
22174317 HIV-1 Rev interacting protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 (DDX24), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20237496 Observational study of gene-disease association. (HuGE Navigator)
18289627 knockdown of a DEAD-box protein named DDX24 inhibits the packaging of HIV-1 RNA and thus diminishes viral infectivity.
18289627 HIV-1 Rev interacting protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 (DDX24), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MKLKDTKSRPKQSSCGKFQTKGIKVVGKWKEVKIDPNMFADGQMDDLVCFEELTDYQLVSPAKNPSSLFS      1 - 70
KEAPKRKAQAVSEEEEEEEGKSSSPKKKIKLKKSKNVATEGTSTQKEFEVKDPELEAQGDDMVCDDPEAG     71 - 140
EMTSENLVQTAPKKKKNKGKKGLEPSQSTAAKVPKKAKTWIPEVHDQKADVSAWKDLFVPRPVLRALSFL    141 - 210
GFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHAVLQWQKRNAAPPPSNTEAPPGETRTE    211 - 280
AGAETRSPGKAEAESDALPDDTVIESEALPSDIAAEARAKTGGTVSDQALLFGDDDAGEGPSSLIREKPV    281 - 350
PKQNENEEENLDKEQTGNLKQELDDKSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAI    351 - 420
LVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE    421 - 490
MLNDSQYNPKRQTLVFSATLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATV    491 - 560
ETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNL    561 - 630
EQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFK    631 - 700
KIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKG    701 - 770
GKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK    771 - 840
TKKPKEPQPEQPQPSTSAN                                                       841 - 859
//

Text Mined References (37)

PMID Year Title
25867071 2016 Negative regulation of the p300-p53 interplay by DDX24.
24980433 2014 MDM2 mediates nonproteolytic polyubiquitylation of the DEAD-Box RNA helicase DDX24.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
More...