Property Summary

NCBI Gene PubMed Count 26
PubMed Score 3.76
PubTator Score 2.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 3.6e-04
atypical teratoid / rhabdoid tumor -1.100 3.1e-07
glioblastoma -1.200 4.3e-06
malignant mesothelioma -1.100 2.2e-06
medulloblastoma -1.100 3.2e-05
osteosarcoma 1.121 2.9e-04
ovarian cancer 1.700 2.7e-04
pancreatic ductal adenocarcinoma liver m... 1.235 4.3e-02

Gene RIF (6)

AA Sequence

MKLKDTKSRPKQSSCGKFQTKGIKVVGKWKEVKIDPNMFADGQMDDLVCFEELTDYQLVSPAKNPSSLFS      1 - 70
KEAPKRKAQAVSEEEEEEEGKSSSPKKKIKLKKSKNVATEGTSTQKEFEVKDPELEAQGDDMVCDDPEAG     71 - 140
EMTSENLVQTAPKKKKNKGKKGLEPSQSTAAKVPKKAKTWIPEVHDQKADVSAWKDLFVPRPVLRALSFL    141 - 210
GFSAPTPIQALTLAPAIRDKLDILGAAETGSGKTLAFAIPMIHAVLQWQKRNAAPPPSNTEAPPGETRTE    211 - 280
AGAETRSPGKAEAESDALPDDTVIESEALPSDIAAEARAKTGGTVSDQALLFGDDDAGEGPSSLIREKPV    281 - 350
PKQNENEEENLDKEQTGNLKQELDDKSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAI    351 - 420
LVGGMSTQKQQRMLNRRPEIVVATPGRLWELIKEKHYHLRNLRQLRCLVVDEADRMVEKGHFAELSQLLE    421 - 490
MLNDSQYNPKRQTLVFSATLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATV    491 - 560
ETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNL    561 - 630
EQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFK    631 - 700
KIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKG    701 - 770
GKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK    771 - 840
TKKPKEPQPEQPQPSTSAN                                                       841 - 859
//

Text Mined References (38)

PMID Year Title