Property Summary

NCBI Gene PubMed Count 17
PubMed Score 38.80
PubTator Score 3.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 7.1e-04

Gene RIF (2)

AA Sequence

MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNW      1 - 70
KALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDR     71 - 140
RAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGP    141 - 210
EAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYV    211 - 280
KPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKY    281 - 350
KPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSD    351 - 420
DA                                                                        421 - 422
//

Text Mined References (23)

PMID Year Title