Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.41
PubTator Score 4.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
cystic fibrosis 1670 1.06428147958371E-5
ovarian cancer 8492 7.49872406224365E-5
pancreatic cancer 2300 0.00232983453331488
primary pancreatic ductal adenocarcinoma 1271 0.0055027616085659
Disease Target Count Z-score Confidence
Hypertension 293 3.056 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.278 0.000
primary pancreatic ductal adenocarcinoma 1.011 0.006
ovarian cancer 1.600 0.000
pancreatic cancer 1.200 0.002

Synonym

Accession Q9GZQ3 D3DWN7 Q9NVN6 Q9UHX5
Symbols HCARG
HT002

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (5)

PMID Text
24515317 the hypertension-related, calcium-regulated gene (HCaRG/COMMD5) is involved in renal repair.
21921141 HCaRG accelerates repair of renal proximal tubules by modulating cell proliferation of resident tubular epithelial cells and by facilitating redifferentiation.
19795399 Observational study of gene-disease association. (HuGE Navigator)
18949406 The up-regulation of HCaRG may be one of the mechanisms underlying the chemopreventive effect of rosiglitazone in gastric cancer.
11871861 The gene for human HCaRG is located on chromosome 8q24.3.

AA Sequence

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR      1 - 70
LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS     71 - 140
VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE    141 - 210
MADLEKRCERRLQD                                                            211 - 224
//

Text Mined References (18)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
24515317 2014 Hypertension-related, calcium-regulated gene (HCaRG/COMMD5) and kidney diseases: HCaRG accelerates tubular repair.
23637203 2013 Functional interaction of COMMD3 and COMMD9 with the epithelial sodium channel.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
21921141 2011 HCaRG accelerates tubular repair after ischemic kidney injury.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21269460 2011 Initial characterization of the human central proteome.
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
More...