Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.61
PubTator Score 4.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
cystic fibrosis 1696 1.1e-05
ovarian cancer 8520 6.7e-05
pancreatic cancer 2398 2.3e-03
primary pancreatic ductal adenocarcinoma 1109 5.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.278 1.1e-05
ovarian cancer 1.500 6.7e-05
pancreatic cancer 1.200 2.3e-03
primary pancreatic ductal adenocarcinoma 1.011 5.5e-03

Gene RIF (5)

AA Sequence

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR      1 - 70
LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS     71 - 140
VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE    141 - 210
MADLEKRCERRLQD                                                            211 - 224
//

Text Mined References (18)

PMID Year Title